Archive

Archive for June, 2011

Fred On Everything

June 30, 2011 Leave a comment

Things stir beyond the frontiers. If we are not to swirl down history’s drain while singing We Shall Overcome, perhaps we should begin again to pay attention to ability. It is one thing, and a good thing, to insist on equality of opportunity. Them as can cut the mustard should have access to mustard. But affirmative action, meaning the hiring of those who would not be hired on their merit, lowers competitiveness in a world that is not going to cut the US any slack. White European males have been far away and gone the world’s most bounteous fountains of the sciences. Maybe we should keep them, even encourage them. The deliberate enstupidation of the schools to favor the unable, to make those who can’t or won’t look as if they could or have, is auto-Kevoirkian governance.

If those who detest white European males can do better, they should. Show me. I am waiting. Meanwhile, let them eat goose who do not like golden eggs.

via Fred On Everything.

June 30, 2011 Leave a comment

THE MYTH OF THE PUBLIC SERVANT: THE OATH TO “PRESERVE, PROTECT AND DEFEND THE CONSTITUTION OF THE UNITED STATES.” : EDRIVERA.COM

June 30, 2011 1 comment

Law enforcement, the cop, deputy sheriff, highway patrol man or other bona fide badge bearer, only enforces the written law. The “Laws of Nature and of Nature’s God” should apply exclusively where government’s written laws do not, however, instead written government law has replaced the “Laws of Nature and of Nature’s God” everywhere.

The myth of the public servant exists to perpetuate the myth that George Washington refused compensation so that he could be a public servant. George Washington gave up compensation so that he could found a dynasty of presidential dictators.

To go beyond the myths, you need a guide and the Basic Course in Law and Government is that guide.

via THE MYTH OF THE PUBLIC SERVANT: THE OATH TO “PRESERVE, PROTECT AND DEFEND THE CONSTITUTION OF THE UNITED STATES.” : EDRIVERA.COM.

THE IMPOSSIBILITY OF LEARNING THE LAW : EDRIVERA.COM

June 30, 2011 Leave a comment

I attended UCLA Law School from 1968 to 1971 and I was admitted to the State Bar of California in 1972. I was a faithful dues paying member of the Bar until 2006, when I was disbarred for telling the truth about law in America.

The truth about the law is there is no law except the orders created by government bureaucrats. You are being ordered about and you call it democracy, because you could vote for the official who casts the aye or nay vote on how you are to live your life.

It is impossible to learn the law from anyone else.

Every other source of legal education will support your continued enslavement by federal, State or local government.

Dr. Eduardo M. Rivera

via THE IMPOSSIBILITY OF LEARNING THE LAW : EDRIVERA.COM.

Poll: Obama would beat Perry (& Palin) in Texas — but lose to Ron Paul & other Republicans (PPP)

June 30, 2011 3 comments

Will the Lone Star state turn blue in 2012?

It isn’t likely — unless Gov. Rick Perry jumps in the ring and clinches the Republican nomination, a new poll from the Public Policy Polling group found.

In the poll’s match-ups, President Barack Obama loses Texas to every notable Republican except Perry and former Alaska Gov. Sarah Palin. If the ballot came down to Perry and Obama, 47 percent of poll respondents said they would vote for Obama. Forty-five percent said they would cast a ballot for Perry.

The most elected Republican in the poll? Mitt Romney.

The poll found that Obama would garner 42 percent of the Texas vote to 50 percent for the former Massachusetts governor. The president trailed Texas Rep. Ron Paul, R-Lake Jackson, by 5 percentage points, 40 percent to 45 percent.

Minnesota Rep. Michele Bachmann leads in Texas, 47 percent to Obama’s 44 percent. Obama also loses to former Minnesota Gov. Tim Pawlenty by 1 percentage point.

Obama would beat out Palin for the state with 46 percent of respondents casting a ballot for his second term and 44 percent voting for Palin…..

(Excerpt) Read more at blog.chron.com …

via Poll: Obama would beat Perry (& Palin) in Texas — but lose to Ron Paul & other Republicans (PPP).

Obama one step closer to his goal of forcing state secession

June 30, 2011 1 comment

The appeals court ruled today in favor of Obama’s “health reform”

The court said Affordable Care Act is a ‘valid exercise’ of congressional power.

Here’s all you need to know. The United States of America is hanging by a thread. If this abomination of a law is upheld by the Supreme Court, several state legislators will defend the constitutional right of their citizens. The gravity of the decision to come by the Supreme Court cannot be mitigated. If this law stands, there will be secession – and the Keynesian Kenyan will likely not leave well enough alone. Since he came here to destroy this country from the day he popped out of nowhere, he would no doubt declare war on the more virtuous half of this land that should be called the GFSA (God Fearing States of America).

If this saboteur wins re-election in 2012 and has his way with this nation for another four years, following is a projection of what the intellectually indolent media will be saying :

“Look at the parallels between Barack Obama and Abraham Lincoln… He’s a second coming of Lincoln, from Illinois, he announced his candidacy in front of the state house where Lincoln served, he campaigned in front of Lincoln images in 2007, he served the same menu at his inauguration, was sworn in on Lincoln’s Bible… AND NOW – he presides over America’s SECOND CIVIL WAR…”

But the leftist sycophants won’t be explaining that this man deliberately instigated and picked at every wound, sowed discord in every fathomable way and deliberately CAUSED the WAR!

His administration has methodically divided this nation day by day, step by step.

This corrupt regime is suing a litany of Border States for simply enforcing the federal laws for which this centralized government was constitutionally chartered – protecting the borders.

They are forcing the states to sue them for forcing citizens to participate in his Marxist healthcare scam. In a time of multiple wars he has forced the legal approbation of homosexuality within all branches of the military.

This Trojan horse is not content to stop there as his administration now seeks to promulgate homosexual “marriage” within the ranks of the military and indoctrinating our soldiers sowing discord in the midst of their engagements.

They are now spitting in the faces of grieving families as they fight to prohibit the use of the word God or Jesus at military funerals of our fallen soldiers (as we have seen this very week in the news).

This administration has worked tirelessly to prevent the enemy combatants from being tried at military tribunals, instead granting these terrorists “constitutional rights” in our own judicial system – rights of a constitution these enemies themselves abhor and are fighting to destroy!

And today, on the same day this federal court upheld this effrontery against our nation, Obama castigated our congress for attempting to save this nation from bankruptcy, demanding like a petulant child that they RAISE taxes in order to codify what will be the death knell to our economy.

This man who was raised by leftists in a disfunctional family, despising every principle upon which this great nation was founded is like a culmination of all our national sins, embodied in one very real individual. He has a plan for America and it makes fictional stories like The Manchurian read like Disney.

via Obama one step closer to his goal of forcing state secession.

ECONOMIC COLLAPSE TO TRIGGER SOCIAL PANDEMONIUM… (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 Leave a comment

 ECONOMIC COLLAPSE TO TRIGGER SOCIAL PANDEMONIUM... News Link  •  Martial Law ECONOMIC COLLAPSE TO TRIGGER SOCIAL PANDEMONIUM 07-29-2009 • Anti-Mullah As the shocking confidential information contained in this briefing shows, the threat of social meltdown and chaos is so large a domestic law-enforcement arm of the U.S. military (referred to by The Army Times as the "Consequence Management Response Force") has been created to deal with what U.S. officials believe to be a coming, unprecedented wave … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

Dave Daubenmire — Homosexuals Are The Real Flakes

June 30, 2011 1 comment

So hear it goes…with all of the love I can muster.

If you support:

• Any man who wants to stick his penis in the rectum of his male friend.

• Any man who would want to engage in “rimming” or “fisting” of another man.

• Any woman who wants to put her face between another woman’s thighs.

• Any person who would teach a young child that sodomy is normal.

• Any teacher who would use children’s books to make such behavior acceptable.

• Any church or denomination that would “welcome” such deviants.

Your position is extreme and I say you are a flake.

If you approve of:

• Any person who would kill an unborn baby in the mother’s womb.

• Any person who would teach a woman that such behavior would not haunt her for the rest of her life.

• Any student of the law who would say that the right to the behaviors listed above can be found in the Constitution.

• Labeling abortion as pro-woman.

• Permitting men to shirk their responsibility by calling abortion a woman’s choice.

Your position is extreme and I say you are a flake.

If you buy into the lie that:

• Spending more money is the best way to get out of debt.

• One’s position in life is dependant on skin color.

• America would not be better off if men married the mother of their offspring.

• It is good to teach children to say “no to drugs” but say yes to sodomy

• Taking guns from law-abiding citizens makes us safer.

• The wars on drugs, poverty, and terror is working

Your position is extreme and I say you are a flake.

If you believe that

• Either political party is looking out for the best interests of the people.

American can remain strong by teaching her children that “all cultures are the same.”

• That light bulbs control the climate of the earth.

• The government has a right to 50% of your income.

• We can’t question the President’s policies because of the color of his skin.

• Mixing Christianity and Islam into Chrislam is a good thing.

Your position is extreme and I say you are a flake.

You get the drift….

via Dave Daubenmire — Homosexuals Are The Real Flakes.

Obama ‘defiance’ of Constitution earns impeachment call

June 30, 2011 2 comments

An organization that represents the 75 percent of American citizens who want more control over illegal immigration is calling for the impeachment of Barack Obama over his involvement in the transfer of weapons to Mexican drug lords and his efforts to provide amnesty to illegal aliens.

“President Obama is no longer the legitimate president of the United States,” said William Gheen, president of Americans for Legal Immigration PAC, in calling for the action today.

Jerome Corsi‘s new book, “Where’s the Birth Certificate?” now is available for immediate shipping, autographed by thet author, only from the WND Superstore.

“By arming drug and human smugglers with assault weapons that have been used to kill American and Mexican citizens and police forces, and by ordering amnesty for illegal aliens which has been rejected by both the Congress and the American public more than eight times, Obama has committed a form of treason against the United States and must be removed from office by Congress,” he said.

(Story continues below)

via Obama ‘defiance’ of Constitution earns impeachment call.

Gunny G: Interesting Read: Admiral Fallon; John McCain; Gen Petraeus; USS Liberty, etc.

June 30, 2011 Leave a comment

Gunny G: Interesting Read: Admiral Fallon; John McCain; Gen Petraeus; USS Liberty, etc.

Interesting Read: Admiral Fallon; John McCain; Gen Petraeus; USS Liberty, etc.

http://72.52.208.92/~gbpprorg/judicial-inc/83fallon_was_born_in_east_orange.htm

http://72.52.208.92/~gbpprorg/judicial-inc/83fallon_was_born_in_east_orange.htm

**********

Hey, See the Reader Responses on each article,

they are gems in themselves!

**********

via BLOGGER.GUNNY.G.1984(+): Gunny G: Interesting Read: Admiral Fallon; John McCain; Gen Petraeus; USS Liberty, etc..

Fallon was born in East Orange

June 30, 2011 Leave a comment

Fallon Was In Charge Of General Petraeus – ‘The Perfumed Prince’

The General picked to succeed Admiral Fallon is a Zionist, who spends his tour in a Baghdad palace, in the fortified Green Zone.

via Fallon was born in East Orange.

With the Obama Myth Shattered, What’s Left is a Failing Narcissist

June 30, 2011 1 comment

BEGIN TRANSCRIPT

RUSH: Freshman Republican Senator Marco Rubio has had his own name for Barack Obama, and this is classic as well. This is from National Review Online at their Corner blog: “Rubio tells us that he will respond to Obama’s recent press conference, where the president reveled in class-warfare bluster. ‘Quite frankly, I am both disappointed for our country and shocked at some of the rhetoric,’ he says. ‘It was rhetoric, I thought, that was more appropriate for some left-wing strong man than for the president of the United States. Talking about corporate jets and oil companies,’ Rubio says, missed the point. ‘Everybody here agrees that our tax code is broken,’ he says, and he is open to discussing tax reform.

“‘But don’t go around telling people that the reason you are not doing well is because some rich guy is in a corporate jet or some oil company is making too much money.’” Well, that’s all Obama’s got. All he has is class warfare. You know, Obama’s out there chiding the Republicans for not acting like grownups. So when’s he gonna go answer questions about jobs or the economy? He just… I don’t know. The White House says they’re gonna host a Twitter town hall with President Obama on July 6, and that’s where the president will answer questions submitted via Twitter which limits messages to 140 characters. “The town hall will focus on jobs and the economy and a video feed of Obama’s answers will be streamed online.” So he’s gonna go answer questions about jobs and the economy on Twitter.

Now, let’s examine Obama a little bit from yesterday, folks. There’s only one reason to play the Fear or the Race or the Sick Children or the Homophobe Card, and that is when you have a losing hand. You have to examine Obama here in the context of his life. He’s never been in this position in his entire life. He has finally had to make decisions — as an executive, not as a voting senator — and those decisions that he’s made have produced results, and the results are disastrous. The results are horrible, and what he’s going to do is parade those horribles in front of the country and try to say that the Republicans are to blame for all this. But these results have come back to haunt him.

They are worried in the White House. They are terrified. They’re not

via With the Obama Myth Shattered, What’s Left is a Failing Narcissist.

The Lesser of Two Evils Rarely Is (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 Leave a comment

************************************** The Lesser of Two Evils Rarely Is by Gary North http://www.lewrockwell.com/north/north536.html by Gary North In December, 1976, I was a staff member for Congressman Ron Paul. In November, he had lost his campaign for re-election by fewer than 300 votes out of over 180,000. My days as a Congressional staffer were numbered – thankfully. The Democrats in that month elected Tip O'Neill the Speaker of the House. … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

THE EXPRESS LANE TO NATURAL BORN CLARITY (Obama is ineligible to be President)

June 30, 2011 Leave a comment

“THE EXPRESS LANE TO NATURAL BORN CLARITY.

The US Supreme Court definition of an Article 2 Section 1 natural-born citizen as stated in Minor v Happersett is strictly limited to those persons born in the United States to parents who were citizens. Below, I will make this crystal clear with stealth to reduce the complexities of the issue into a refined exposition and mantra the average citizen will easily comprehend.

NATURAL BORN CLARITY

The Supreme Court in Minor specifically avoided construing the 14th Amendment as to the issue of whether Virginia Minor was a US citizen. Instead, the Court looked no further than the natural-born citizen clause in Article 2 Section 1. The Court held that Minor was a member of the “class” of persons who were natural-born citizens. They defined this class as those born in the US to “parents” (plural) who were citizens. (For more detailed analysis of this issue, see my two previous reports, here and here.)

The Court also noted that the “citizenship” of those born to non-citizen parents was subject to doubt. Since Virginia Minor was in the class of natural-born citizens, that doubt didn’t need to be resolved. The Court exercised judicial restraint and thereby avoided construction of the 14th Amendment as to the citizenship issue.

Such avoidance and restraint were called for. In order for the Court to act, there must be a genuine controversy with regard to the laws in question. Since there was no controversy before the Court involving a 14th Amendment citizenship issue, the Court decided the issue on other grounds, specifically Article 2 Section 1.

Now we turn to US v. Wong Kim Ark. In that case, the US Supreme Court held that (some) persons born in the United States of alien parents were “citizens”. In doing so, the Court stated that it was specifically construing only the 14th Amendment. And here lies the rub of clarity:

If Wong Kim Ark had been a natural-born citizen, the Supreme Court would never have reached the 14th Amendment issue (just as it didn’t reach it in Minor.)

That statement is a perfectly true mantra. Read it again… and again, until it sinks in. Then share the mantra. There is no antidote for it. There is never an antidote for truth.

THE NATURAL BORN CITIZEN CLAUSE HAS NOT BEEN AMENDED OR REPEALED.

via THE EXPRESS LANE TO NATURAL BORN CLARITY (Obama is ineligible to be President).

The Secret History of Our Time: The Pope and Satan, War and the Anti-Christ, Revelations and the Last Days ~ Richard C. Cook (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 Leave a comment

The Secret History of Our Time: The Pope and Satan, War and the Anti-Christ, Revelations and the Last Days Author’s Note: In order to come up with an accurate understanding of today’s world crisis it is necessary to start looking at it from the spiritual dimension. This essay attempts to do so, using sources acquired during many years of study. By the latter half of the 19th century, say at the time of the great Chicago Columbian Exposition of 18 … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

The Great Gulf Coast Holocaust Pt 1

June 30, 2011 Leave a comment

The Great Gulf Coast Holocaust Pt 1

06-29-2011 • Farm Wars

There are other voices, albeit quieter voices, outside of the mainstream media and the BP propaganda machine, which tell a far different side of BP’s efforts “to make it right.” Consider the case of Empire, Louisiana fisherman, Elmer Rogers,

Read Full Story

via The Great Gulf Coast Holocaust Pt 1.

Massachusetts Case Will Set Precedent Regarding Videotaping Of Cops

June 30, 2011 Leave a comment

Massachusetts Case Will Set Precedent Regarding Videotaping Of Cops

06-30-2011 • www.pixiq.com

Four years ago, Boston police officers arrested a man for videotaping them making an arrest in a public park.

They charged Simon Glik with felony wiretapping, disturbing the peace and aiding the escape of a prisoner – even though all he did was hold up a video camera – and the man they were arresting did not escape.

The charges were quickly dropped and Glik eventually filed a lawsuit for false arrest, claiming his First and Fourth Amendment rights had been violated.

The police officers filed a motion to dismiss his complaint on the basis on “qualified immunity,” which is their way of claiming they had no idea videotaping cops in public was completely legal.

A judge denied that motion and they appealed, which brought the issue back to court last week.

Now another judge will decide whether the cops will be granted qualified immunity, which would set a legal precedent that cops can basically make unlawful arrests of citizens who videotape them without fear of repercussions.

Read Full Story

via Massachusetts Case Will Set Precedent Regarding Videotaping Of Cops.

The Moral Promise of Freedom (The Waco Prophet Was Right)

June 30, 2011 Leave a comment

The methods and strategies of the government’s assault against Waco had been used for years by the military, but against foreign governments and their leaders, not against the domestic citizenry. The most familiar case of foreign intrigue was the government’s attack on Manuel Noriega, in which it used similar tactics (blaring music, planting evidence, spreading disinformation), and therein lies the connection between foreign policy and domestic. Anything a government allows itself to do to foreign countries will eventually be done at home. That’s one reason George Washington warned us against foreign entanglements.

We may never know the full truth about Waco or the extent of government perfidy, but we can draw lessons from the experience. This particular event was a fiasco, but it also tells something about what our government has become: “the organizer-in-chief of society,” as Bertrand de Jouvenel said, which is “making its monopoly of this role ever more complete.” It is a parasite and a monster that acts to protect itself. Mises was right: government’s nature is coercive. It is “beating, killing, hanging.” Coercion is necessary in society to protect the rights of property holders against those who do not respect property. But when government itself become the source of arbitrary violence, we have tyranny. That’s why unchecked power should never be invested in a centralized government, even one with a democratic mandate. This power will invariably be exercised at the expense of peaceful social relations.

In its dealings with the community of believers at Mount Carmel, the central government abandoned the moral promise of a free society, and, as all tyrannies eventually do, ignored its own standards of law and ethics. But it paid the price of losing some measure of public confidence, which is already at historic lows. A government that governs by fear alone eventually finds itself unable to govern at all.

Dr. Ron Paul is a Republican member of Congress from Texas.

via The Moral Promise of Freedom.

Obama Gives New Grant to ACORN; Did He Violate Federal Law?

June 30, 2011 2 comments

Why is Obama apparently defying federal law by funding ACORN?

Judicial Watch discovered the administration is flouting the will of Congress by giving federal money to ACORN.

Obama’s HUD gave a $79,819 grant to the largest branch of the ACORN tree, ACORN Housing Corp. . AHC filed papers last year legally changing its name to Affordable Housing Centers of America.

Worse yet, the grant funds a political agitation and indoctrination program. Here’s HUD’s euphemistic description of the program:

Education and Outreach Initiative grants (EOI) – HUD awarded $6.8 million to organizations that educate the public and housing providers about their rights and obligations under federal, state, and local fair housing laws. Groups will also conduct fair lending workshops, community meetings, and individual counseling activities focused on homeowners at risk for discrimination.

According to HUD, the grant money came out of fiscal 2010 appropriations.

That’s a big problem.

As I reported previously, in 2009 Congress passed four separate appropriations bills that contained language blocking federal funds from flowing to ACORN during federal fiscal year 2010, which ran from Oct. 1, 2009 through Sept. 30, 2010. All four laws prevent ACORN and its affiliates from receiving taxpayer dollars.

[snip]

Yet despite the ban, President Obama, who worked for ACORN as an employee and as the group’s lawyer, found it in his heart to hand over $79,819 of your money to his thug friends at ACORN.

As I warn in my new book, Subversion Inc.: How Obama’s ACORN Red Shirts are Still Terrorizing and Ripping Off American Taxpayers, ACORN is still with us, doing its best to destroy American capitalism and democracy.

The group is gearing up right now to make sure President Obama gets reelected in 2012. Its state chapters have adopted assumed names and remain active. Project Vote, ACORN’s vote manufacturing factory, continues to operate unmolested in ACORN’s Washington, D.C. office.

You’ve been warned.

(Excerpt) Read more at spectator.org …

via Obama Gives New Grant to ACORN; Did He Violate Federal Law?.

J.B. Williams Speaks Out For America!

June 30, 2011 Leave a comment

J.B. Williams Speaks Out For America!

J.B. Williams Speaks Out For America!

http://www.newswithviews.com/JBWilliams/williamsA.htm

*****

Read more »

via BLOGGER.GUNNY.G.1984(+).

Ray Jacobs: “.That’s when I discovered Dick Gaines’s Gunny G web site.Dick uses Lowery’s classic picture of the first flag raising on his home page.I e mailed him that I was the radioman in that picture.” (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 Leave a comment

Ray Jacobs: ".That's when I discovered Dick Gaines's Gunny G  web site.Dick uses Lowery's classic picture of the first flag raising on his home page.I e mailed him that I was the radioman in that picture." Ray Jacobs: ".That's when I discovered Dick Gaines's Gunny G  web site.Dick uses Lowery's classic picture of the first flag raising on his home page.I e mailed him that I was the radioman in that picture." ***** Excerpts "D + 4 on Iwo Jima was Friday,February 23,1945.At about 10:30 hours I was standing on the broad rim of the crater on top of Suribachi looking up at our colors snapping in the breeze._" "Suddenly something extraordinary happened.W … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

Part 2 in the “Me Offended” Series| The Post & Email

June 30, 2011 Leave a comment

IS SHARIA LAW BEING IMPLEMENTED IN AMERICA BY STEALTH?

by One Pissed-off Vietnam Vet

“FITNA” is a film produced in 2008 by the Dutch filmmaker Geert Wilders warning of the radical nature of Islam

(Jun. 30, 2011) — At the conclusion of “What? Me Offended? You Bet,” we were introduced to the American acronym of the word “JIHAD”: Join in Halting America’s Destruction. Since that article was written, America has opened her arms and welcomed the Muslim Brotherhood: you know, the Iranian-sponsored terror organization that overthrew the Egyptian leader and is now starting to implement Sharia Law there by killing Christians, amongst others.

Muslims have taken over countries for centuries and have perfected the method of doing so as a purely predictable science. Step One is to convince the populace that is being conquered that Islam is a “peaceful religion” rather than a Totalitarian system of government that renders women second-class citizens who have absolutely no control over their lives and, consequently, live a life of horror as slaves and subject to an “honor beating” or an “honor killing” at the whim of their male handlers, be they a father, uncle, brother, husband, or religious police, such as the Taliban.

The second step that Muslims force upon an unsuspecting people is

via Part 2 in the “Me Offended” Series| The Post & Email.

Glenn Beck, Fox end dark, nasty cable era today (major hurl alert)

June 30, 2011 1 comment

2:12:30 PM by Lucky9teen

When Glenn Beck signs off today at the end of his last Fox News cablecast, he will leave a TV legacy of reckless, divisive and ugly speech in his wake. He and Fox News should both feel some shame for the harm they have done to the national political discourse — how they have taken an hour of dinnertime each weeknight and used it to help polarize us with paranoid and angry words.

But, of course, Fox and Beck seem to have no shame, do they? In the case of Fox News, it thinks good ratings are all that matter. And in the case of Beck, it’s all about the new projects he has and his claim to make $30 to $40 million a year, with only a tenth of that having come from Fox.

Good for them and their skewed value systems.

I will tell you something, I did much of my Ph.D. dissertation research on the blacklisting of the 1950s, and Glenn Beck’s speech and attacks were as nasty and dirty as any of it. And there is no one who can absolve Fox News for loosening those ugly forces on American life again at a time when we as a nation need to come together to solve massive problems like no time since World War II.

Tell me about how Beck will end his Fox run in third or fourth place overall in cable news ratings, and I’ll ask you at what price? He and Fox did it by speaking to our worst demons and betraying any notion of public trust that comes with being a cablecaster and part of the American press.

via Glenn Beck, Fox end dark, nasty cable era today (major hurl alert).

Disunited Americans Cannot Stand Up To Washington Tyranny

June 30, 2011 1 comment

Americans are a doomed people for many reasons. One reason is that they are disunited and at one another’s throats and, thus, cannot stand up the tyranny issuing from Washington.

For example, the governments of Georgia, Alabama, and Florida, states that share borders, have been fighting for more than two decades over the water in Georgia’s Lake Lanier, located a few miles northeast of Atlanta. In 2009 a federal district judge ruled that it is illegal for water to be drawn from the lake to meet the needs of Atlanta’s three million residents. The judge stipulated that the three states had until July 2011 to reach an agreement, failing which Atlanta would be restricted to the amount of water it received in the mid-1970s, when its population was less than one-third of its present size.

Obviously, the ruling was a major incentive to Alabama and Florida not to compromise. Either the judge gave no thought to this fact or he was unconcerned that 3 million Atlantans would find themselves in drought circumstances.

At the last moment on June 28, with two days to go before Atlanta was cut off from its water supply, a federal appeals court ruled that the district court judge’s decision was incorrect and gave the US Corps of Engineers one year to make a final decision concerning the allocation of Lake Lanier’s water to the three states.

via Disunited Americans Cannot Stand Up To Washington Tyranny.

Exposing the Government’s Lies by Jacob Huebert (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 Leave a comment

"Everything the State says is a lie, and everything it has it has stolen." ~ Friedrich Nietzsche, Thus Spake Zarathustra Judge Andrew Napolitano opens his new book, Lies the Government Told You, with that quote, and that's the book's theme: the State is our enemy because it constantly lies, steals, and kills. Radical Libertarianism That's a pretty radical idea, so this is a radical book. This is not a book about "public policy," about how we migh … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

Obama’s ineligibility: It is time to create a genuine opposition (Dim bulb Dick Durbin video)

June 30, 2011 1 comment

The 2012 election is underway and it will be a street fight, whose outcome will determine if the United States survives as a republic.

It is futile writing to Congress for the redress of grievances. They are only interested in getting elected, not in representing their constituents.

Senator Dick Durbin (D-IL) is the Senate Majority Whip, the second highest position in the Democratic Party leadership in the Senate.

To me Dangerous Dick is indicative of how far the Congress has degenerated.

(snip)

Durbin thinks that it is acceptable for an illegal immigrant to become President.

If you recall, it was also Durbin who compared American soldiers to Nazis.

To the untrained eye Durbin may seem like he is either an idiot or insane. He is not.

You see, like his other pals in Congress, Durbin expects to be Senator-for-life along the lines of Haiti’s Baby Doc Duvalier.

Durbin and the Democrats don’t really care about illegal immigrants as future professionals, but as future voters.

By giving illegal immigrants amnesty before the 2012 election, the Democrats believe that they can guarantee an election victory for Obama and regain control of Congress.

Their aim is permanent political power, a one-party state like Robert Mugabe’s Zimbabwe.

And the feeble and impotent Republicans will acquiesce in the hope that they will be the last ones eaten by the crocodile.

(Excerpt) Read more at canadafreepress.com …

via Obama’s ineligibility: It is time to create a genuine opposition (Dim bulb Dick Durbin video).

Introduction to Lies The Government Told You by Andrew P. Napolitano (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 Leave a comment

What is it about the government and its agents and employees that they can lie to us with impunity, but we risk being sent to jail if we lie to them? Throughout this book, I will suggest answers to these and similar questions. As I do so, you'll see a chip on my shoulder. I am angry that we allow the government to lie to us, that we expect it to do so, and even take comfort in the illusions created thereby. When I told friends about the title of … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

“We are now living in a new era of time called post Judeo/Christian America” (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 30, 2011 1 comment

"We are now living in a new era of time called post Judeo/Christian America" . The believing evangelical church of America today has been so distracted by Washington politics that it has neglected the REALITY that the Kingdom of Heaven is at our very door! Of course as believers we should do our part as American citizens to give our voice etc., but that day is far past us. We are now living in a new era of time called post Judeo/Christian America … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

A Gunny G Excerpt: “Why The Gun Is Civilization” (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

A while ago, I posted a little essay called "Why the Gun is Civilization". It was pretty well received, and got me a lot of positive comments from a variety of people. Some folks asked for permission to reprint and publish the essay in various newsletters and webzines, and I gladly granted it every time, only asking for attribution in return. Recently, I have noticed my essay pop up on the Internet a lot in various forums, most of which I do not … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

The Presidency and Mythology by Andrew P. Napolitano (via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

Franklin Roosevelt manipulated the United States into World War II for years prior to a declaration of war. The Japanese surprise attack on Pearl Harbor on December 7th 1941 was not only not a surprise, but was facilitated by FDR. Abraham Lincoln was a racial supremacist who wanted blacks forcibly removed to Africa. Woodrow Wilson arrested people for speaking German in public. If these facts were as well known as the fiction that has surrounded t … Read More

via ~ BLOGGER.GUNNY.G.1984+ ~ (BLOG & EMAIL)

Roberts’ Court Deep In Tank For Privileged (Gigantic Hurl Alert!!!)

June 29, 2011 Leave a comment

The U.S. Supreme Court now sees its central task as comforting the already comfortable and afflicting those already afflicted.

If you are a large corporation or a political candidate backed by lots of private money, be assured that the court’s conservative majority will be there for you, solicitous of your needs and ready to swat away those pesky little people who dare to contest your power.

This court has created rules that will have the effect of declaring some corporations too big to be challenged through class actions, as AT&T consumers and female employees at Wal-Mart discovered.

And remember how sympathetic conservatives are supposed to be to the states as “laboratories of democracy,” pioneering solutions to hard problems? Tell that to the people of Arizona.

They used a referendum to establish a highly practical system of financing political campaigns designed to reduce corruption and give a fighting chance to candidates who decide to forgo contributions from special interests.

The people acted, noted Justice Elena Kagan in a brilliantly scalding dissent, after a scandal in which “nearly 10% of the state’s legislators were caught accepting campaign contributions or bribes in exchange for supporting a piece of legislation.”

Corporate Power

Under Arizona’s “clean elections” initiative, candidates who raised a modest amount in very small contributions could receive a lump sum of public money. They could raise no further private funds.

(Excerpt) Read more at investors.com …

via Roberts’ Court Deep In Tank For Privileged (Gigantic Hurl Alert!!!).

Bachmann: ‘Sense of urgency’ in U.S. | ATLAH Media Network

June 29, 2011 Leave a comment

Bachmann: ‘Sense of urgency’ in U.S.

via Bachmann: ‘Sense of urgency’ in U.S. | ATLAH Media Network.

Commander: Special operations forces under stress

June 29, 2011 1 comment

WASHINGTON – The military commander who directed the raid that killed Osama bin Laden is warning that the escalating demands on U.S. special operations forces are hampering their training and could slowly eat away at their combat readiness.

Vice Adm. William McRaven said demand for the elite forces around the world continues to grow, so there often isn’t enough time to train between deployments. And he said the helicopters and other equipment they need are not available to units in the United States who are preparing to deploy.

Special operations forces “cannot indefinitely sustain current levels of overseas presence,” said McRaven, who has been nominated to replace Adm. Eric Olson as commander of the U.S. Special Operations Command. “The resulting pressure on the force and our families is too great, and the pressure is creating a dramatic effect on our readiness.”

He said the short breaks between deployments limit training in key language skills and the regional and cultural expertise that enable the commandos to work well in other countries. And he noted that most of the helicopters needed for training are either at the warfront or in maintenance, making it difficult for aircrews to hone their skills.

The lack of helicopters, aircraft and ships at bases in the U.S., he said, limits training on refueling, live bomb drops or dock landings.

McRaven’s comments came in answer to questions from the Senate Armed Services Committee during a hearing Tuesday and in a written questionnaire obtained by The Associated Press. And they mirror, in part, observations made by Olson earlier this year, when he warned that the elite forces were “beginning to show some fraying around the edges.”

(Excerpt) Read more at foxnews.com …

via Commander: Special operations forces under stress.

THE CULTURE of VIOLENCE in the AMERICAN WEST MYTHS Vs. REALITY ~ By: Thomas J. DiLorenzo (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

THE CULTURE of VIOLENCE in the AMERICAN WEST MYTHS Vs. REALITY ~ By: Thomas J. DiLorenzo THE CULTURE of VIOLENCE in the AMERICAN WEST MYTHS Vs. REALITY By: Thomas J. DiLorenzo EXCERPT The Real Cause of Violence in the American West The real culture of violence in the American West of the latter half of the nineteenth century sprang from the U.S. government’s policies toward the Plains Indians. It is untrue that white European settlers were always at war with Indians, as popular folklore contends. After all, Indians assisted the Pilgr … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Ann Coulter: GLENN BECK VS. THE MOB (A Relentless Demonic Mob)

June 29, 2011 Leave a comment

GLENN BECK VS. THE MOB

June 29, 2011

Of all the details surrounding the liberal mob attack on Glenn Beck and his family in New York’s Bryant Park last Monday night, one element stands out. “No, it won’t be like that, Dad,” his daughter said when Beck questioned the wisdom of attending a free, outdoor movie showing in a New York park.

People who have never been set upon by a mob of liberals have absolutely no idea what it’s like to be a publicly recognizable conservative. Even your friends will constantly be telling you: “Oh, it will be fine. Don’t worry. Nothing will happen. This place isn’t like that.”

Liberals are not like most Americans. They are the biggest pussies on Earth, city-bred weaklings who didn’t play a sport and have never been in a fight in their entire lives. Their mothers made excuses for them when they threw tantrums and spent way too much time praising them during toilet training.

I could draw a mug shot of every one of Beck’s tormentors, and I wasn’t there.

Beck and his family would have been fine at an outdoor rap concert. They would have been fine at a sporting event. They would have been fine at any paid event, mostly because people who work for the government and live in rent-controlled apartments would be too cheap to attend.

Only a sad leftist with a crappy job could be so brimming with self-righteousness to harangue a complete stranger in public.

A liberal’s idea of being a bad-ass is to say vicious things to a conservative public figure who can’t afford to strike back. Getting in a stranger’s face and hurling insults at him, knowing full well he has too much at risk to deck you, is like baiting a bear chained to a wall.

They are not only exploiting our lawsuit-mad culture, they are exploiting other people’s manners. I know I’ll be safe because this person has better manners than I do.

These brave-hearts know exactly what they can get away with. They assault a conservative only when it’s a sucker-punch, they outnumber him, or he can’t fight back for reasons of law or decorum.

Read More »

via Ann Coulter: GLENN BECK VS. THE MOB (A Relentless Demonic Mob).

Economic Collapse a Mathematical Certainty

June 29, 2011 3 comments

The dollar collapse will be the single largest event in human history. This will be the first event that will touch every single living person in the world. All human activity is controlled by money. Our wealth,our work,our food,our government,even our relationships are affected by money.

No money in human history has had as much reach in both breadth and depth as the dollar. It is the de facto world currency. All other currency collapses will pale in comparison to this big one. All other currency crises have been regional and there were other currencies for people to grasp on to.

This collapse will be global and it will bring down not only the dollar but all other fiat currencies,as they are fundamentally no different. The collapse of currencies will lead to the collapse of ALL paper assets. The repercussions to this will have incredible results worldwide.

(Excerpt) Read more at youtube.com …

via Economic Collapse a Mathematical Certainty.

Read This Book! by Ron Paul

June 29, 2011 1 comment

This is the foreword to Lies the Government Told You by Andrew P. Napolitano

Andrew P. Napolitano is a true rarity among judges and media personalities: He is a passionate defender of liberty who understands that the United States Constitution puts strict limits on federal power. Judge Napolitano’s tremendous knowledge of American law, history, and politics, as well as his passion for freedom, shines through in Lies the Government Told You, as he details how throughout American history, politicians and government officials have betrayed the ideals of personal liberty and limited government.

Anyone who knows Judge Napolitano understands that he does not pull his punches or excuse any constitutional violations in order to support any group or political interest. Thus, Lies the Government Told You explains how politicians of both parties have routinely disregarded the constitutional limits on federal power and violated our natural rights.

One of the most important lessons Judge Napolitano teaches is how many shared premises there are by advocates of big government from both the right and the left. For example, Judge Napolitano exposes how both the conservatives’ war on marijuana and the liberals’ war on tobacco are manifestations of paternalism — the idea that government has the legitimate authority to stop adults from doing bad things, like smoking substances that politicians and bureaucrats do not approve of. Of course, smoking, whether of marijuana or tobacco, does have negative health consequences — but respecting the right of individuals to be wrong, as long as they do not interfere with the rights of others, is one of the pillars of a free society.

Lies the Government Told You also avoids the all-too-common error of drawing a distinction between “personal” liberty and “economic” liberty, and focusing on attacks on one type of freedom while ignoring or even supporting attacks on the other category of liberty. When the freedom movement began in the nineteenth century, supporters of liberty, who were then known as “liberals,” made no distinctions between government actions that interfered with economic liberties, such as laws infringing upon private contracts, and government actions that restricted personal liberty, such as limits on the freedom of speech. Supporters of liberty were also likely to understand the grave threat posed to liberty and constitutional government by a militaristic foreign policy. Thus, they were also supporters of peace.

However, beginning in the Progressive Era, promoters of big government co-opted the rhetoric of the promoters of freedom, even stealing the label “liberal.” Whereas liberal once referred to a supporter of freedom, beginning in the Progressive Era, the term liberal began to refer to supporters of the welfare state. The division between supporters of “economic” and “personal” freedoms was accelerated by the Cold War, when many supporters of free markets allowed their (justifiable) loathing of communism to lead them to embrace militarism abroad and limitations on personal freedom at home. Thanks to this division between the supporters of personal and economic liberty, it is not uncommon to find opponents of socialized medicine arguing for the Patriot Act, and supporters of gun control arguing for free speech.

Fortunately, Judge Andrew P. Napolitano is one of a

via Read This Book! by Ron Paul.

The Presidency and Mythology by Andrew P. Napolitano

June 29, 2011 2 comments

Franklin Roosevelt manipulated the United States into World War II for years prior to a declaration of war. The Japanese surprise attack on Pearl Harbor on December 7th 1941 was not only not a surprise, but was facilitated by FDR. Abraham Lincoln was a racial supremacist who wanted blacks forcibly removed to Africa. Woodrow Wilson arrested people for speaking German in public. If these facts were as well known as the fiction that has surrounded them, then the information which the government wishes us to accept uncritically about the present day state of affairs would be more vigorously challenged. So here is the lesson: The government has mythologized the past in order to lull us into accepting its version of the present; and the essence of that mythology is the presidency.

When Lincoln stated at Gettysburg that government is of the people, by the people, and for the people, that was government propaganda. The government is not of the people, and it shares none of the characteristics and traits of the people themselves. No less a president than George Washington told us that government is not reason, it is force. Government is a tool, a powerful and a dangerous tool. And so it must be wielded carefully and only when moral, constitutional, necessary, and proper. Government officials are not performing a public service, and they do not regard themselves as public servants. They regard themselves as our masters.

Under the Constitution and the law, as I’ve said time and again on this show, they are employees of the people and ought to serve at our pleasure. When we lionize our government officials, be they Presidents or postal workers, when we mythologize and deify them, when we build temples to worship them, we violate the nature of the service they ought to be performing. Jefferson would be scandalized at the temples we have built for him. Lincoln and FDR would no doubt welcome theirs. If we want to take our government back, we must begin by taking an honest account of what our government has done, ostensibly in our names, and reject the untrue narratives it instead foists upon us. The truth shall set us free.

All presidents but Jefferson have argued that their first job was to keep us safe. All presidents but Jefferson were wrong. If you read the Constitution, you will see that the President’s first job – as Jefferson understood well – is to keep us free.

via The Presidency and Mythology by Andrew P. Napolitano.

Martial Law in the Land of Confusion! by Gary D. Barnett

June 29, 2011 Leave a comment

In October of 2008, the 3rd Infantry Division’s 1st Brigade Combat Team, a very “elite” combat squad, became the first active duty military unit to be dedicated and deployed for domestic use. This means the virtual elimination of the protections afforded us by the Posse Comitatus Act against federal military forces acting as domestic police. This is certainly an important step toward the implementation of Martial Law.

In January of 2010, President Obama signed Executive Order 13528, which established the Council of Governors. These governors are appointed directly by the president for the stated purpose of building a state/national police partnership. This fascist partnership was put into place to build a “legal” partnership between the federal government’s national military force and the domestic police agencies, so that they became one and the same. The scariest part about this is that this force would be fully controlled by the executive branch of government, making this a federally controlled domestic police force! I wrote about this here.

In 2010 Obama authorized the targeting of U.S. citizens for assassination, thus continuing another heinous Bush policy. Glenn Greenwald of Solon discusses this policy in detail in this article.

I have only touched the surface of course, as these things are only a few of the most obvious invasions of our liberty, but as you can see, these past ten years have brought an avalanche of liberty destroying policies and legislation to our doorstep. We are being bombarded continuously with more bad laws and more police state abuses. This behavior is increasing at an alarming rate, and the populace it seems is still mostly unresponsive to these intrusions by government.

Due to all these government actions, the stage has been set for Martial Law. But will it come, and if so, what events will trigger this state assault on us all? First, just consider where we are currently as a nation. Economically speaking, we are in dire straits. The national debt now stands at 14.3 trillion dollars. That doesn’t count all the hidden debt owed by the taxpayers that is sitting at Fannie Mae and Freddie Mac, which is several trillion dollars more. Also not included are the unfunded liabilities of Social Security, Medicare, and Prescription Drugs, which total over 113 trillion dollars. Current annual deficits are running above 1.5 trillion dollars with no end in sight. And the Fed continues to create money out of thin air, and the government keeps spending. This is a recipe for disaster.

Real unemployment as calculated by the well-respected John Williams at Shadow Government Statistics is 22%, which means that approximately 33,000,000 people are now out of work. The government is only reporting 8.8% by its fraudulent U-3 method, or 13,000,000. When this many people are out of work, a huge drain on the system is the result, and desperation takes hold.

The U.S. killing machine is now openly advancing aggressive wars in Afghanistan, Iraq, and Libya, and is covertly involved in military actions in several other countries. Besides murdering innocents abroad, the cost to run the military and to prosecute these immoral wars is over a trillion dollars a year.

Predator drones are being used to murder people in the Middle East on a regular basis, but they are also being used for domestic law enforcement. These computer game-like spying drones can be used for surveillance, and they can also be used for target killing. The fact that they are flying over our towns and cities is frightening.

Our money is being purposely destroyed every single day so that this corrupt government can monetize the massive debt it created. The Federal Reserve is a most willing accomplice in this scheme to bankrupt our society. If in fact our money continues to lose value at this pace, and massive or hyperinflation is the result, our wealth will simply disappear.

The state governments are in deep trouble as well, and they don’t have the power of the printing press to temporarily cover up their mistakes. State pensions are broke in some cases, and vastly underfunded for future obligations in most others. When the checks stop going out, frustration and anger will take over.

The TSA gropes, fondles, and intimidates those traveling daily. This is done to instill fear, and to habituate the sheep like populace into a herd mentality. It is meant to turn the citizens into serfs. The abusive and brutal behavior by state and local police, and other agents of the government, is increasing dramatically. It is increasing in numbers, but it is also increasing in severity. In 2007, Paul Craig Roberts wrote about this in his article titled America‘s Police Brutality Pandemic, but since the time of that writing, this problem has increased exponentially, and is still worsening.

As I said earlier, the stage is set for a police state takeover of our streets. The government has in place all the legislation, tools, and gendarmes it needs to implement Martial Law. It has a militarized police system armed and ready to act. It has a domestic military force trained in urban warfare. It has holding centers ready to house those who don’t go along or who practice civil disobedience. The government has the capability to listen to every conversation, to track our location, to monitor all our computers and email, and can shut down our communication systems, including the Internet at will.

via Martial Law in the Land of Confusion! by Gary D. Barnett.

Exposing the Government’s Lies by Jacob Huebert

June 29, 2011 Leave a comment

“Everything the State says is a lie, and everything it has it has stolen.”

~ Friedrich Nietzsche, Thus Spake Zarathustra

Judge Andrew Napolitano opens his new book, Lies the Government Told You, with that quote, and that’s the book’s theme: the State is our enemy because it constantly lies, steals, and kills.

Radical Libertarianism

That’s a pretty radical idea, so this is a radical book.

This is not a book about “public policy,” about how we might limit the rate of government’s growth, or about how to “reform” this or that program. It’s not really even about “getting back to the Constitution.”

Instead, this book is about exposing the criminal acts of our rulers in Washington, and about abolishing and repealing powers and programs wholesale.

How principled is Napolitano here?

Take eminent domain. Even some libertarians decry “eminent-domain abuse” and complain about government taking property for purposes that aren’t a “public use” as the Constitution supposedly requires — as though taking people’s property by force for some purposes might be okay.

Judge Napolitano will have none of that. He writes that the concept of private property inherently entails “the right to exclude [others] . . . even the right to exclude the government.” So instead of wanting to curb the “abuses” or condoning eminent domain in some cases, Napolitano says abolish eminent domain.

Through such stances, Judge Napolitano, here as never before, shows himself to be solidly in the same uncompromising libertarian camp as his fellow LewRockwell.com columnists. Also, throughout the book, he cites names that will be familiar to LRC readers, such as Murray Rothbard, Lew Rockwell, Ron Paul (who wrote the foreword), Thomas DiLorenzo, and William Anderson. And the book takes the “libertarian populist” tone often found on LRC, including just the right balance of scholarly analysis, easy readability, and moral outrage. So if you like this website, you’ll almost certainly like this book.

It shows a lot of courage for Napolitano to take this approach, given that he works at Fox News Channel alongside some people who attack anyone who opposes the warfare and police state as not merely wrong but un-American and evil.

Big Lies

via Exposing the Government’s Lies by Jacob Huebert.

Introduction to Lies The Government Told You by Andrew P. Napolitano

June 29, 2011 Leave a comment

What is it about the government and its agents and employees that they can lie to us with impunity, but we risk being sent to jail if we lie to them?

Throughout this book, I will suggest answers to these and similar questions. As I do so, you’ll see a chip on my shoulder. I am angry that we allow the government to lie to us, that we expect it to do so, and even take comfort in the illusions created thereby. When I told friends about the title of this book, I frequently joked that it would be four thousand pages in length. Most laughed; but none doubted that there have been enough government lies to consume that many printed pages.

When you recall that the Declaration of Independence and the Constitution of the United States mandate a free and open society, one in which the government works for us, you can see where the chip on my shoulder came from. It is morally reprehensible for any government to lie to anyone over whom it has lawful authority. But in a free and open society where we are the employers, and the government workers are the employees, every government employee — from a public school janitor to a state governor, from a soldier to an FBI agent, from a cop to the President — has a lawful obligation to be truthful to his or her employers, and it is utterly and completely and unconditionally unacceptable to treat as normal that they should lie to us.

And yet, treat it as normal we do. Just look at the names of the chapters in this book — from “All Men Are Created Equal” to “Congress Shall Make No Law . . . Abridging the Freedom of Speech,” from “Innocent Until Proven Guilty” to “Your Boys Are Not Going to Be Sent into Any Foreign Wars” to “We Don’t Torture” — and you will see the stuff of which historical myth is made. Every one of those well-known, well-worn, well-stated canards is a goal the government has never reached but claims it has. Each has become a bald-faced lie, a perpetrated myth, a grasp at power, a monstrous deception. And most of us recognize that.

Why do we believe government-generated myths? Why do we allow the use of myth to enhance government power? Why do we condone the government’s use of deception to crush our freedom, steal our property, and destroy our lives? And how does the government get away with all this?

These are the questions we will explore in the coming pages

via Introduction to Lies The Government Told You by Andrew P. Napolitano.

A New Battle In Obama’s Class War, Today’s Press Conference

June 29, 2011 Leave a comment

An old thread with a 1939 conservative booklet (”The Revolution Was”) about FDR and the New Deal. It’s all happening again, almost down to the same wording that Obama uses. It is a long booklet, but here is an excerpt as pertains to “obscene profits”.

http://www.freerepublic.com/focus/f-news/2185147/posts

In his first inaugural address, March 4, 1933, the President said: “… Yet our distress comes from no failure of substance…. Plenty is at our doorstep, but a generous use of it languishes in the very sight of the supply…. Practices of the unscrupulous money-changers stand indicted in the court of public opinion, rejected by the hearts and minds of men…. They know only the rules of a generation of self-seekers…. Yes, the money-changers have fled from their high seats in the temple of our civilization. We may now restore that temple to the ancient truths. The measure of that restoration lies in the extent to which we apply social values more noble than mere monetary profit.”

There was the pattern and it never changed. The one enemy, blameable for all human distress, for unemployment, for low wages, for the depression of agriculture, …. for want in the midst of potential plenty — who was he? The money-changer in the temple. This was a Biblical symbol and one of the most hateful…

Large profit as such becomes therefore a symbol of social injury, merely because it is large; moreover, it is asserted that large profit had long been so regarded by the government and penalized for that reason.

Of all the counter symbols this was the one most damaging to the capitalistic system. Indeed, if it were accepted, it would be fatal, because capitalism is a profit and loss system and if profits, even very large profits, are socially wrong, there is nothing more to be said for it. But it was a false symbol, and false for these three reasons, namely: first, there is no measure of large profit; second, large profits are of many kinds and to say simply that large profits are “of course made at the expense of the neighbors” is either nonsense or propaganda, as you like; and; in the third place, the history is wrong….

So, what the New Deal really intended to do, what it meant to do within the Constitution if possible, with the collaboration of Congress if Congress did not fail, but with war powers if necessary, was to REORGANIZE AND CONTROL THE WHOLE ECONOMIC AND THEREFORE THE WHOLE SOCIAL NETWORK OF THE COUNTRY.

And therein lay the meaning — the only consistent meaning — of a series of acts touching money, banking and credit which, debated as monetary policy, made no sense whatever.

via A New Battle In Obama’s Class War, Today’s Press Conference.

On Sheep, Wolves, and Sheepdogs -LTC Dave Grossman (ret) – (excellent!)

June 29, 2011 1 comment

On Sheep, Wolves, and Sheepdogs – Dave Grossman By LTC (RET) Dave Grossman, author of “On Killing.”

###

Honor never grows old, and honor rejoices the heart of age. It does so because honor is, finally, about defending those noble and worthy things that deserve defending, even if it comes at a high cost.

In our time, that may mean social disapproval, public scorn, hardship, persecution, or as always,even death itself.

The question remains: What is worth defending? What is worth dying for? What is worth living for? – William J. Bennett – in a lecture to the United States Naval Academy November 24, 1997

via On Sheep, Wolves, and Sheepdogs -LTC Dave Grossman (ret) – (excellent!).

Policing the Police: The Apps That Let You Spy on the Cops

June 29, 2011 Leave a comment

After the recent Vancouver riots, it became clear that the world is surveiling itself at an unprecedented scale. Angry citizens gave police one million photos and 1,000 hours of video footage to help them track down the rioters. If we aren’t living in a surveillance state run by the government, we’re certainly conducting a huge surveillance experiment on each other.

Which is what makes two new apps, CopRecorder and OpenWatch, and their Web component, OpenWatch.net, so interesting. They are the brainchildren of Rich Jones, a 23-year-old Boston University graduate who describes himself as “pretty much a hacker to the core.” Flush with cash and time from a few successful forays into the app market, nine months ago Jones decided to devote some of his time to developing what he calls “a global participatory counter-surveillance project which uses cellular phones as a way of monitoring authority figures.”

CopRecorder can record audio without indicating that it’s doing so like the Voice Memos app does. It comes with a built-in uploader to OpenWatch, so that Jones can do “analysis” of the recording and scrub any personally identifying data before posting the audio. He said he receives between 50 and 100 submissions per day, with a really interesting encounter with an authority figure coming in about every day and a half.

via Policing the Police: The Apps That Let You Spy on the Cops.

Meet the Woman Who Threw Wine on Glenn Beck at NY Picnic: LINDSEY PISCITELL

June 29, 2011 Leave a comment

Pics, email, and proof the wine spill was planned. Meet the idiot woman who spilled the wine on Glenn Beck. “MEET OUR A**HOLE OF THE WEEK: LINDSEY PISCITELL.” Follow the links….

(Excerpt) Read more at google.com …

via Meet the Woman Who Threw Wine on Glenn Beck at NY Picnic: LINDSEY PISCITELL.

Why Did This Happen? by Thomas DiLorenzo

June 29, 2011 Leave a comment

Having created an economic depression, the same government then threatened the end of the world as we know it unless we all acquiesced in giving trillions of dollars to the financiers of the Democratic and Republican parties, the big Wall Street banks. More than 70 percent of the public opposed this according to opinion polls which, during the presidential campaign, were treated as Holy Gospel by the media and Washington elite. When billionaire New York City Mayor Michael Bloomberg sued the Fed to learn who, exactly, the money was given to, the federal courts essentially gave him a great big middle finger and told him to get lost.

During the 1970s many American pundits ridiculed the British practice of bailing out failing industries because it caused “the British Disease,” i.e., a grossly inefficient and uncompetitive economy. Subsidizing business failure breeds more failure. We are now doing the same thing, but many orders of magnitude greater. The most egregious example of this disastrous policy is the billions of tax dollars promised General Motors and Chrysler and their productivity-destroying unions.

Economists used to fear inflation

via Why Did This Happen? by Thomas DiLorenzo.

AMERICA’S TWO-PARTY SYSTEM IS A HOAX (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

AMERICA'S TWO-PARTY SYSTEM IS A HOAX "America's political system as set up by our Founding Fathers had no political parties or factions. It wasn't that they didn't know about political parties, but that they were unwelcome. When looking at the factions of Europe, our Founders didn't like what they saw – political intrigue, conspiracy, and hostile divisions. They were afraid that such a system would rip apart the Union. They hoped that in free elections it would be natural for the be … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Erin and Rudy’s New World Order | ATLAH Media Network

June 29, 2011 Leave a comment

Erin and Rudy’s New World Order

via Erin and Rudy’s New World Order | ATLAH Media Network.

Dr James manning…

Give Us Liberty ~ BREAKING!!!!!!! ALIPAC requesting immediate IMPEACHMENT proceedings begin against the USURPER!!!!

June 29, 2011 1 comment

This Blog

Linked From Here

This Blog

Linked From Here

Loading…

Wednesday, June 29, 2011

BREAKING!!!!!!! ALIPAC requesting immediate IMPEACHMENT proceedings begin against the USURPER!!!!

The national organization called Americans for Legal Immigration PAC – - – (ALIPAC) – - – just made a public announcement that it is calling for the Impeachment of President Barack Obama for reasons stated in their press release. ALIPAC has sent out notices to the 137 current members of Congress that it endorsed and supported to help them win their seat in Congress – - – requesting immediate IMPEACHMENT proceedings begin against President Barack Obama in the interest of public safety and stability.

via Give Us Liberty.

BARACK OBAMA RUSSIAN PLANT? NEW EVIDENCE (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

BARACK OBAMA RUSSIAN PLANT? NEW EVIDENCE BARACK OBAMA RUSSIAN PLANT? NEW EVIDENCE . A research group tried to contact this man of the “The first time I heard of Barack” story back in January to no avail. His purported name was Tom Fife. Here’s the link: http://gunnyg.wordpress.com/2009/03/14/update-the-first-time-i-heard-of-barackby-tom-fife/ It’s next to impossible to prove the following – as nearly everything else about Obama's life before October 1992 – but it is believed by some res … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Police Officers, Fed Up with Rick Scott, Leave Republican Party En Masse

June 29, 2011 1 comment

Don’t be fooled folks. Obama’s thugs are behind this. They know if they loose Florida they lose the 2012 election.

via Police Officers, Fed Up with Rick Scott, Leave Republican Party En Masse.

Why Does the Tea Party Avoid the Eligibility Issue?| The Post & Email

June 29, 2011 1 comment

“YOUR SILENCE IS DEAFENING”

Dear Tea Party:

The Tea Party movement coalesced in a gathering of perhaps 1,000,000-2,000,000 in Washington, DC in September 2009 protesting government spending and lack of accountability of elected officials

(Jun. 29, 2011) — I don’t know which “Tea Party” I am writing to in this email…..there are SO many of you that claim that YOU were the ones that formed this mighty club…..but the fact that since 2008…….you have become a strong, persuasive force in America does nothing for me…..

Why?

Am I not glad that you are trying to control the debt? Yes.

Am I not glad that you are trying to make taxes fair? Yes.

Am I not glad that you can influence elections with more conservative candidates like you did in November? Yes.

So what’s my problem?

Let me just ask you one simple question…….when Barack Obama released his long-form birth certificate two months ago, did you all breathe a sigh of relief…..”Ahhhh, thank goodness!! Boy, we are SO glad he finally did that so we can get back to more important matters?”

Did you? Did you believe it to be the REAL thing…and there was NO chance that it might need to be forensically examined for its validity?

via Why Does the Tea Party Avoid the Eligibility Issue?| The Post & Email.

Soros Getting His Fingers in Prosser-Bradley Kerfuffle (Wisconsin Supreme Court)

June 29, 2011 Leave a comment

Jonathan Tobin writes at Commentary Contentions that a Soros-supported group is behind the trumped-up charges that Wisconsin Supreme Court Justice David Prosser “choked” a liberal colleague of his, Ann Walsh Bradley:

via Soros Getting His Fingers in Prosser-Bradley Kerfuffle (Wisconsin Supreme Court).

Google launches all out social networking assault with Google+ (video)

June 29, 2011 Leave a comment

Social networking has long been Google’s white whale. The company has done plenty of dabbling in the space, releasing Orkut, which has failed to catch on in the US, and rolling out Buzz to the relative indifference of its massive user base. Announced today after seemingly endless leaks, Google+ represents a major push for the software giant. The service began showing itself to a smattering of users last night, as a black bar across the top of various of the company’s properties. A “+You” button on the far left of the bar currently brings you to the service’s landing page, offering a tour of the many features that fall under the Google+ umbrella. Get to know the services better after the break.

Continue reading Google launches all out social networking assault with Google+ (video)

via Google launches all out social networking assault with Google+ (video).

Police Officers, Fed Up with Rick Scott, Leave Republican Party En Masse

June 29, 2011 Leave a comment

Next month the Broward County Police Benevolent Association is holding a “Party to Leave the Party” — an event coordinated with the Supervisor of Elections where police officers and the general public can switch their voter registrations from Republican to Democratic or Independent…So here are the details: On Saturday, July 16, from 11 a.m. – 3 p.m. behind the PBA headquarters on SW 26th Terrace in Fort Lauderdale, the union will have elections officials standing by to register new voters or switch party registrations for anyone with a valid Florida ID.

(Excerpt) Read more at blogs.browardpalmbeach.com …

via Police Officers, Fed Up with Rick Scott, Leave Republican Party En Masse.

Give Us Liberty

June 29, 2011 Leave a comment

Congress – Yes, Obama Is Above The Law

By Devvy

Exclusive to Rense

“I am concerned for the security of our great nation, not so much because of any threat from without, but because of the insidious forces working from within.” – General Douglas MacArthur.

As anyone who doesn’t live in a self-imposed coma can see, Americans are beyond frustrated and very, very angry at the Outlaw Congress for refusing to do their constitutional duty regarding the forgery released by Obama/Soetoro, April 27, 2011, purported to be his long form birth certificate.

The charlatans in the “mainstream” media darn n

via Give Us Liberty.

Flashmobbery in Philly: 100 Youths Storm Through City Center on Robbery & Assault Rampage

June 29, 2011 1 comment

Flashmobbery in Philly: 100 Youths Storm Through City Center on Robbery & Assault Rampage

Gateway Pundit ^ | 6-29-11 | Jim Hoft

Posted on Wednesday, June 29, 2011 2:45:28 PM by Justaham

Mob of 100 youths rob and assault restaurant patrons in Philadelphia on Saturday night.

via Flashmobbery in Philly: 100 Youths Storm Through City Center on Robbery & Assault Rampage.

Obama’s Plan: Divide, Demonize And Threaten

June 29, 2011 1 comment

In his press conference today President Barack Obama did what we’d expect more from a terrorist than the leader of the free world. He threatened that if we don’t give him more money, the nation’s food supply may be compromised. His exact words when answering a question about negotiations to raise the nation’s $14.3 trillion debt ceiling: “If we choose to keep those tax breaks for millionaires and billionaires…then that means we’ve got to cut some kids off from getting a college scholarship. That means we’ve got to stop funding certain grants for medical research. That means that food safety may be compromised. That means that Medicare has to bear a greater part of the burden.”

So if those stubborn Republicans in Congress don’t give in; our nation’s children will be stupid, we won’t cure cancer, grandma won’t get medical care but none of that matters anyway because we’ll all drop dead from eating tainted food. Mr. Obama really is a talented orator. In just a few seconds of speaking he managed to fan the flames of class warfare, demonize more than half of the US Congress and terrorize the American people. Al-Qaida would be proud!

(Excerpt) Read more at talkingsides.com …

via Obama’s Plan: Divide, Demonize And Threaten.

Why America Lost the “Civil War” contributed by Nat G. Rudulph Selma, Alabama (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

Why America Lost the "Civil War" contributed by Nat G. Rudulph Selma, Alabama (Reblog) ***** Why America Lost the "Civil War" contributed by Nat G. Rudulph Selma, Alabama "Civil War" is at best a misleading name for that conflict. Many Southerners avoid using it because of the implication that there were factions in every locality. "Civil" means "relating to the people within a community." The term describes only one aspect of the event, and subt … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Why America Lost the “Civil War” contributed by Nat G. Rudulph Selma, Alabama (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

Why America Lost the "Civil War" contributed by Nat G. Rudulph Selma, Alabama (Reblog) ***** Why America Lost the "Civil War" contributed by Nat G. Rudulph Selma, Alabama "Civil War" is at best a misleading name for that conflict. Many Southerners avoid using it because of the implication that there were factions in every locality. "Civil" means "relating to the people within a community." The term describes only one aspect of the event, and subt … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Give Us Liberty

June 29, 2011 Leave a comment

Unknowingly Esquire Magazine has opened the door to have the evidence of fraud presented in a federal court when they wrote in their satire disclaimer about their story about Joe Farah pulling Jerry Corsi’s book off the shelves…

Opening the Back Door to the Obama Eligibility Lock Down

by Teo Bear | TheBirthers.org

The Courts, Congress and for the most part the Mainstream Media have effectively closed the door to any serious legal challenges to Obama’s lack of constitutional eligibility. That is about to change.

via Give Us Liberty.

Alec Baldwin: Bachmann inarticulate, full of s**t, someone to be feared (Potty Mouth Pin Head)

June 29, 2011 Leave a comment

30 Rock” actor Alec Baldwin took to Twitter Tuesday evening to rant and rave about Rep. Michele Bachmann’s fundraising ability.

Baldwin, who only started tweeting last month, suggested the Minnesota congresswoman’s early success is due to her connection with “thuggish interests.”

via Alec Baldwin: Bachmann inarticulate, full of s**t, someone to be feared (Potty Mouth Pin Head).

Hate the Game, Not the Players

June 29, 2011 Leave a comment

Today, all of that has changed. Beginning with Ron Paul’s 2008 presidential campaign, the word “libertarian” can now be heard over the mainstream airwaves again. As the present presidential primary contest gets underway, not only Paul but former New Mexico governor Gary Johnson are openly referred to as “libertarian candidates,” despite the fact that they are seeking the Republican nomination for president. Mainstream media pundits now routinely refer to a significant minority of Republican legislators as “libertarian-leaning.” The “L-word” has been de-stigmatized. Over the next several years, it seems likely that libertarianism is going to get another hearing.

While all of this is great news, it does beg some very important questions. What was the reason for the stigmatization in the first place? More importantly, why has the libertarian movement failed to get off the launch pad after such an auspicious start in the 1970’s?

Certainly the biggest hurdle for libertarianism has been its difficulty for most people to accept. With true liberty comes an enormous amount of personal responsibility. As W. Somerset Maugham wrote,

via Hate the Game, Not the Players.

Supreme Court Returning Original Intent

June 29, 2011 1 comment

The Roberts court is very carefully, across the Constitution, laying the groundwork for a return to original intent, and this is just one of many blocks in the foundation they are building.

Last year it was gun rights and the Second Amendment. There have been a series on free speech, notably in this year’s overturning of California’s restrictions on violent video game sales to minors, and regarding political speech both last term with Citizens United and this term with the overturning of Arizona’s public financing of elections.

Notice that Scalia is being assigned many of these cases, and that his brilliant (and witty) mind is creating clarity where believers in a living Constitution would deliberately create murkiness.

(Excerpt) Read more at punditpress.blogspot.com …

via Supreme Court Returning Original Intent.

Alan Stang Review: An Enormous Crime, by Billy Hendon (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 29, 2011 Leave a comment

My Dear Gunny, Here are Parts I and II of my review of the new POW book An Enormous Crime. Go ahead and reprint if you like what you see. Here is Congressman Billy Hendon's review of my review: _____________________________________________ dear mr. stang, i just read your part 1 piece on the pow issue, and i must tell you it is magnificent – the most well-written, perceptive and on-target analysis of this national tragedy that has ever been writt … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Hijacked Democracy / We Are Now A Fascist Corpocracy | Veterans Today

June 29, 2011 Leave a comment

Mark Twain once wrote true patriotism, the only rational patriotism, is loyalty to the Nation ALL the time and loyalty to the Government ONLY when it deserves it. Our present corporate welfare state government does not deserve our loyalty for it has not only hijacked democracy but we have become a fascist corpocracy in the process.

by Allen L Roland

Do you realize that the U.S. military spends a cool $20billion on air conditioning annually in Iraq and Afghanistan. The U.S. military forks out a whopping $20.2 billion a year on keeping troops in Iraq and Afghanistan cool, it has emerged. This alarming figure is more than Nasa’s entire annual budget and trumps the amount the G-8 has pledged to aid Egypt and Tunisia. It’s even more than the clean up cost of BP’s Gulf oil spill. See full report

The Obama administration not

via Hijacked Democracy / We Are Now A Fascist Corpocracy | Veterans Today.

Prospective Candidate for President Wants to Raise Eligibility Issue| The Post & Email

June 29, 2011 Leave a comment

Prospective Candidate for President Wants to Raise Eligibility Issue

Share 0diggsdigg

TO DATE, NO OTHER CANDIDATE HAS DONE SO

by Cody Robert Judy

Cody Robert Judy was set to announce his candidacy for the presidency on June 21, but has held back for lack of funds

(Jun. 29, 2011) — I wanted to give you a tidbit of an update regarding the article published at The Post & Email on June 15, 2011. As you may have noted, June 21, 2011 passed and I did not formally commit in a Declaration of Candidacy. You no doubt noticed Mr. Jon Huntsman’s declaration on that same day which I opened the door for and let pass through so as not to disparage.

Another notice for you is…………………………..

 

via Prospective Candidate for President Wants to Raise Eligibility Issue| The Post & Email.

Ron Paul On 2012: Establishment, Media Unable To Exclude Me This Time Around

June 29, 2011 1 comment

Texas Congressman Ron Paul feels much more optimistic about his 2012 presidential run than he did prior to his 2008 campaign, primarily because he knows that the establishment can no longer exclude him from debates and national polls.

Ron Paul On 2012: Establishment, Media Unable To Exclude Me This Time Around 070507paul

The Congressman spoke exclusively to The Alex Jones show yesterday to give the inside track on the progress of the campaign, his thoughts on the ailing economy and to express his concerns over the precedent being set by US involvement in the military action in Libya.

Paul addressed those in the media, as well as political opponents, who have previously resorted to dirty tricks and smear in an attempt to discredit The Congressman’s campaign, noting:

“We have made progress, and that is because there are a growing number of people who are onto their tricks and are watching them rather closely, and they are going to hear from the supporters if they start doing that. So, in spite of the obstacles, our job is to keep doing what we’re doing and gain supporters.”

“The laughing and the ridicule

via Ron Paul On 2012: Establishment, Media Unable To Exclude Me This Time Around.

Bond v. United States and Standing to Challenge Putative President Obama on His Eligibility to be President| The Post & Email

June 29, 2011 3 comments

WHO POSSESSES “STANDING,” AND WHY?

by Mario Apuzzo, Esq., ©2011

(Jun. 29, 2011) — The U.S. Supreme Court on June 16, 2011 decided Bond v. United States, 564 U. S. ____ (2011). The Bond decision does not say anything that has not been expected regarding filing a case which can establish standing to challenge Putative President Barack Obama on his legitimacy to be President. It has always been my position that a criminal defendant or someone being compelled to pay money challenging an Obama-endorsed Congressional statute which is the basis for the criminal charge against him or her or the money payment requirement will have standing to attack that law and in so doing also to challenge Obama’s legitimacy to be President. This is not to say that this is the only way that our courts should recognize someone like the plaintiffs I represented in Kerchner v. Obama, 612 F.3d 204 (3rd. Cir. 2010), cert. denied, 131 S.Ct. 663 (2010), who raised legitimate claims of injury to their Fifth Amendment right to life, liberty, safety, security, and tranquility, to have standing to file an action challenging Obama’s eligibility to be President under the “natural born Citizen” clause of Article II, Section 1, Clause 5.

In the Bond case, Congress passed…………………………

 

via Bond v. United States and Standing to Challenge Putative President Obama on His Eligibility to be President| The Post & Email.

NAFTA, Agenda 21, and Border 21

June 29, 2011 1 comment

Barack Obama’s deal with the president of Mexico to allow Mexican trucks to carry their loads onto U.S. highways and roads is new evidence of his high-handed solo behavior that has become Standard Operating Procedure in the Administration. Here are ten reasons why Obama’s plan is dangerous and must be stopped by Congress and public protest.

1. Obama’s deal with President Felipe Calderon, announced on March 3, bypasses Congress, defies the wishes of the American people, and looks like the action of a Third World dictator who thinks representative government is a nuisance and can be ignored.

(Excerpt) Read more at whatisagenda21.net …

via NAFTA, Agenda 21, and Border 21.

GUNNY G: “Most Americans (so-called) are ignorant as to what the Constitution intended, says, does not say, its history, etc.”

June 29, 2011 2 comments

Gunny G:

Most Americans (so-called) are ignorant as to what the Constitution intended, says, does not say, its history, etc.

But they seem to like it that way!

Ref

http://gunnyg.blogspot.com/2011/06/gunny-g-u-s-constitution-apparently-not.html#links

*****

**********
Hey, See the Reader Responses on each article,
they are gems in themselves!

**********

http://i46.tinypic.com/2rptut4.jpg
**********
Gunny G: BLOGGER 1984 +
http://gunnyg.blogspot.com

and…
http://gunnyg.wordpress.com/

**********

**********
**********

“This is What Treason Looks Like”| The Post & Email

June 29, 2011 Leave a comment

 

“This is What Treason Looks Like”

10Share 0diggsdigg

OBAMA SEEKS TO PROMOTE GENERAL WHO VIOLATED THE POSSE COMITATUS ACT IN SAMSON, AL IN 2009

by Sharon Rondeau

General Martin Dempsey has been nominated to succeed Admiral Michael Mullen as Chairman of the Joint Chiefs of Staff

(Jun. 29, 2011) — On May 30, 2011, Obama named General Martin Dempsey to replace Admiral Michael Mullen, who is retiring on September 30, 2011 from his position as Chairman of the Joint Chiefs of Staff. Dempsey reportedly was in charge of investigating why 22 military police and a provost marshal were dispatched to the small town of Samson, AL on March 10, 2009, after a man murdered ten people and then committed suicide. The deployment of U.S. Army personnel was found to be in violation of the Posse Comitatus Act, which “restrains the use of the military for civilian law enforcement purposes.” The investigation eventually concluded that the law had been broken and that “soldiers should not have been sent.”

Martin has been in his current position as Chief of Staff of the U.S. Army for only slightly over two months.

via “This is What Treason Looks Like”| The Post & Email.

WHAT HAS RON PAUL ACCOMPLISHED?

June 29, 2011 Leave a comment

2 posted on Wednesday, June 29, 2011 9:59:41 AM by gunnyg (“A Constitution changed from Freedom, can never be restored; Liberty, once lost, is lost forever…)

via WHAT HAS RON PAUL ACCOMPLISHED?.

WHAT HAS RON PAUL ACCOMPLISHED?

June 29, 2011 Leave a comment

Apparently, Ron Paul wasted no time jumping into the pool of candidates, running for the Presidency 2012. As I understand it, this is his third time running for president, and has been elected 12 terms as Congressman from Texas. This means he has conducted 15 political campaigns.

My question what has he accomplished? He has held a seat of power in Congress 24 years, while this country has been on a fast track slide into Socialism. What has he done to stop it or even slow it down?

No need to remind me he has an ongoing campaign to audit the feds. A farfetched notion, that takes up time and space and goes no place. Anyway, the feds are already audited. Seems to me if anyone really wanted to change that government boondoggle in effect since 1913, it would be more logical to change the laws to do away with it. This country thrived and did well before it was established.

What is his voting record? Is there anything in it, that presents any evidence Congressman Paul has done anything of any significance to salvage the Principles upon which this nation was founded?

There are 535 congressmen elected to occupy a seat of power in Washington. These representatives took an oath to uphold the Constitution. All of them draw substantial salaries, and most, if not all, maintain offices in Washington and their home state with staff. They all have travel expenses and other perks of expense. Occupying this seat of power for 24 years, conducting all the political campaigns, must have cost the citizens of this country a lot of money.

What has Congressman Paul done to curtail the trillions of indebteness, as one of the 535 who have deliberately placed this once great nation this far in debt? What has he done for victory of the unwinnable wars the Congress has backed, lo these many years?

The school system in this country has an annual cost of 100 billion, and does not educate, instead indoctrinates young children into the tenets of Socialism. What has Congressman Paul done in past 24 years to effect any change in this system? Just to mention a few questions.

In his campaign speeches, debates, newsletters, and TV interviews, I hear what he says, and he is quite well informed about economics, but what has he done to effect changes for the better in any areas of the ditch this country is in? He talks the talk but does not walk the walk.

I’m just absolutely amazed at all the current hoopla over his latest announcement, i.e., candidate for President of United States, by so many well-intentioned, intelligent people in this country. Where is the rationale of pinning hopes for a solution to the crisis we face, on one individual who has occupied a position of power over the citizenry for over 24 years, at a cost of untold millions, showing no meaningful solutions nor results?

Despite all the propagandi to the contrary, each passing year, month, and day, conditions in this country go from bad to worse. Are we living in a pepetual Emperor’s Clothing parade, or what? Why is there such a huge blindspot and denial of who and what got us to this place in history? Why does the average person refuse to recognize the truth about what got us here, and insist upon repetitition?

And more importantly, how come the majority thinks we can vote ourselves out of the ditch we voted ourselves into? Ours is not a nation of stupid people, but why the repetition of stupid acts? Who out there has not heard what Einstein said? “Insanity is doing the same thing over and over expecting different results.” What is it about that simple statement of fact, so difficult to understand?

Why is it so many are listening and supporting Ron Paul, when after 24-plus years, being one in a position of power to effect positive changes, just simply continues being part of the problem, talking the talk, and not walking the walk. To consider taking off rose-colored glasses, I suggest going back and reading my posted article during last election cycle and reading “Debates & Dear John Letter.” The problem and solution so simple a child can understand it.

Alexis de Tocqueville said: “All those who seek to destoy the liberties of a democratic nation, ought to know that war is the surest and shortest means to accomplish that.”

via WHAT HAS RON PAUL ACCOMPLISHED?.

What happened to freedom?

June 29, 2011 Leave a comment

What happened to freedom?

By Henry Lamb web posted June 27, 2011

To listen click here

When Constitutional scholar Barack Hussein Obama, and the assortment legal advisors that surrounds him, decided that the commerce clause authorized the federal government to force private citizens to purchase a product, freedom vanished from America.

With this newly declared authority, the federal government can force its citizens to do anything the government wishes. This omnipotent power is the same power exercised by the governments of Hitler, Stalin, and all other despots who have denied freedom to their citizens.

What happened to freedom? It was erased, little by little, until we no longer have a choice among the types of light bulbs we buy. Government has dictated that its citizens can no longer buy a 40-cent incandescent light bulb; after January 1, formerly free people living in a formerly free-market system will be forced by government to buy a four-dollar light bulb, probably made in China.

(Excerpt) Read more at enterstageright.com …

via What happened to freedom?.

Stanley Monteith — The Secret Cabal, Part 17

June 29, 2011 Leave a comment

If you want to oppose the centralization of power that exists today, you must recognize the fact that the major (BOD) corporations control over half of the corporate wealth of our nation. When Senator William Borah addressed the Union League Club in Baltimore, Maryland, on February 12, 1913, he stated:

“If one-quarter of 1 percent of all the corporations in the United States, as they have and do, control one-half of all corporate wealth and fix prices on many of the most essential things in our daily living, then, as to the most vital things in life, the means and standard of living, concentration of economic power is already established, and, if continued, concentration of governmental power to meet the situation will inevitably follow.”[2]

Did one-quarter of 1 percent of the U.S. corporations control half the corporate wealth of the U.S. in 1913? Professor Carroll Quigley researched that subject, and wrote; (in 1966):

“In the United States the number of billion-dollar corporations rose from one in 1909 (United States Steel, controlled by Morgan) to fifteen in 1

via Stanley Monteith — The Secret Cabal, Part 17.

Dave Hodges — The Great Gulf Coast Holocaust, Part 1

June 29, 2011 Leave a comment

“The law does not pretend to punish everything that is dishonest. That would seriously interfere with business.” -Clarence S. Darrow

It’s been labeled the worst environmental disaster in world history, and rightfully so, because the British Petroleum (BP) oil spill in the Gulf of Mexico is like the nightmarish gift that keeps on giving.

On April 20, 2010, the Macondo well blew out resulting in the loss of 11 lives, sank the Deepwater Horizon drilling rig and spilled an estimated five million barrels of crude oil into the Gulf of Mexico. BP’s swath of destruction has included the decimation of the welfare, livelihoods, health and futures of tens of millions of Gulf Coast residents, not to mention the destruction of the fragile ecology in the Gulf of Mexico.

This is first of a multi-part series which answer questions in five specific areas related to the oil spill with regard to the actions of BP, its corporate Gulf Coast partners and the federal government before, during and after the catastrophe. These areas of inquiry include the following:

1. Has BP made full restitution to the oil spill victims?

2. Has BP’s actions, as a result of the attempted clean up following the oil spill, resulted in serious health concerns for untold numbers of Gulf Coast residents and is United States government and the main stream media complicit in covering up the scope and the magnitude of these health effects?

3. Has BP, as it claims,

via Dave Hodges — The Great Gulf Coast Holocaust, Part 1.

“I Have Enough Money”: words of wisdom from Chairman Obama «Coach is Right

June 29, 2011 Leave a comment

In David Mamet’s recent book, “The Secret Knowledge”, he quotes President Obama as saying,

“The individual at some point must be able to say:

‘I have enough money. [Therefore, I no longer need to work, toil, or sweat; after all, I have enough money. I no longer need to earn and pay taxes; after all, I have enough money. I no longer need to plant or harvest; after all, I have enough money. I no longer need to build or produce; after all, I have enough money. I no longer need to use my skills, my cleverness, or my muscles; after all, I have enough money. I no longer need to use my education (achieved at great public expense; after all, I have enough money. I no longer need to apply my vast knowledge and experience; after all, I have enough money.

I invented electricity, the light bulb, the telephone, the automobile, the television, the PC, the Internet, and GPS, but I no longer need to invent nor innovate; after all, I have enough money. I discovered cures for infection and disease, but I need discover no more; after all, I have enough money.

I no longer need to tend the lame, the ill, or set broken bones; after all, I have enough money. I no longer need to defend my country from its enemies; after all, I have enough money. I no longer need to protect my fellows from evil lawbreakers; after all, I have enough money. I no longer need to extinguish the fires which may burn my fellows and th

via “I Have Enough Money”: words of wisdom from Chairman Obama «Coach is Right.

Give Us Liberty

June 29, 2011 Leave a comment

BETWEEN THE LINES

What if that birth certificate is phony?

Exclusive: Joseph Farah says media downright fearful over Obama document

WND

via Give Us Liberty.

Give Us Liberty

June 29, 2011 Leave a comment

Obama’s ineligibility: Proof that Congress is lying

By Lawrence Sellin Full Story

For patriotic Americans, this is our Cuban Missile Crisis. Make Congress blink.

Congress has always known that Barack Obama is not a natural born citizen and has never been eligible to be President, yet they continue to lie to the American people.

via Give Us Liberty.

Who Da Flake? Obama Da Flake…

June 29, 2011 Leave a comment

For a nice, large list of Obama gaffes and goofs, see Blonde’s great compilation at the Newsbusters Forums pages.

via Who Da Flake? Obama Da Flake….

Is Obama Making His Next Career Move? (UN Secretary General or Caliphate?)

June 29, 2011 Leave a comment

Obama always seems to crave more ego gratification. There is no limit to his thirst for personal power and glory. The slogan “The Audacity of Hope” is taken straight from Napoleon’s creed, “L’audace, l’audace, toujours l’audace!” Always act audaciously on the battlefield, because your opponents will never predict your dangerous moves. Your enemies will be shocked and overwhelmed by the risks you take.

That’s how Napoleon managed to kill tens of millions of Europeans in his attempt to conquer the world after 1800. George Patton used the audacity strategy to beat Nazi armored divisions in World War II. Hitler used it with the Blitzkrieg. It’s also the theory of the Big Lie: You tell such breath-taking whoppers that normal people can’t imagine that you don’t believe a word of it yourself. Most people will believe in Big Lies more than little lies, if you repeat the Big Lies over and over again — and if you control the Organs of Propaganda. Which the left did until the internet arose.

Obama has a lifetime of faith in an imperialistic creed, Leninist-Marxism of the third-world variety. That was the dream his Kenyan father had.

So it’s not just his mysterious birth certificate. Obama is a psychological stranger to normal American politics, and intuitively many Americans grasp that. Compare Obama to Ronald Reagan, Sarah Palin, or Herman Cain, and you get it immediately. It’s just like the Sesame Street jingle, “One of these is not like the others…” Obama’s differentness has nothing to do with skin color. It’s his fundamental beliefs, his political style, and his personal morality. At some level everybody gets that.

But Obama is also a calculating politician. Like all running politicians, he projects complete faith that he’ll win in 2012.

(Excerpt) Read more at americanthinker.com …

via Is Obama Making His Next Career Move? (UN Secretary General or Caliphate?).

Ancient stones a mystery for archeologists, scientists [ Los Lunas Decalogue ]

June 28, 2011 Leave a comment

.if they had the means to explore various parts of Europe and Asia by boat, then they certainly had the means to cross the seas to the Americas.

One such item of interest is a large stone that was found in a dry creek bed in New Mexico. This stone discovered by early explorers contains the entire Ten Commandments written in Ancient Hebrew script. Today, this large stone still lies where it was originally found in the early 1800′s on the side of Hidden Mountain near Los Lunas, New Mexico, about thirty-five miles south of Albuquerque.

Scholars who have studied the stone say it pre-dates the arrival of Columbus to America.

How did this large stone with the Ten Commandments written in Ancient Hebrew come to be in North America? No one has an answer.

Another item that shows strong evidence of the possibility of Hebrews in America is noted in a custom celebrated by the Yuchi Indians in Oklahoma.

The Yuchis originally migrated from the Bahamas to Florida and Georgia and then later to the Oklahoma territory.

(Excerpt) Read more at yourhoustonnews.com …

via Ancient stones a mystery for archeologists, scientists [ Los Lunas Decalogue ].

Why Barack H. Obama Jr. Is Not Eligible To Be President| The Post & Email

June 28, 2011 Leave a comment

AND IS NOT PRESIDENT OF THESE UNITED STATES OF AMERICA

by Donald R. Laster Jr., ©2011

The lawsuit Purpura v. Sebelius claims that the health care law signed last year violates the U.S. Constitution and that the person having signed it is an imposter president

(Jun. 28, 2011) — Editor’s Note: The following document is part of the appendix in the case Purpura v. Sebelius, which claims that the Patient Protection and Accountability Act is unconstitutional and that Obama is not eligible to serve as president.

The Post & Email covered the case here and here, and it has been covered extensively at Conservative News and Views.

The Jersey Shore Tea Party is a plaintiff in the case, as are many other organizations and individuals. Fifteen constitutional violations have been cited as reasons for the legislation to be vacated. The 15th item claims that the bill violates the Tenth Amendment of the Bill of Rights, which the U. S. Supreme Court recently ruled takes precedence over federal law in keeping with the Framers’ concept of federalism.

via Why Barack H. Obama Jr. Is Not Eligible To Be President| The Post & Email.

http://www.thepostemail.com/2011/06/28/why-barack-h-obama-jr-is-not-eligible-to-be-president/

Estulin: Elitists Consider Assassinating Ron Paul (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 1 comment

Estulin: Elitists Consider Assassinating Ron Paul Estulin: Elitists Consider Assassinating Ron Paul Best-selling author and Bilderberg sleuth says intelligence sources told him highest levels of U.S. government discussing what result would be if Congressman was killed Paul Joseph Watson Prison Planet Friday, December 14, 2007 Best-selling author and Bilderberg sleuth Daniel Estulin says he has received information from sources inside the U.S. int … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Gunny G: A Most Amazing Story, From “Sully” (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

Piggyback Hero by Ralph Kenney Bennett Tomorrow they will lay the remains of Glenn Rojohn to rest in the Peace Lutheran Cemetery in the little town of Greenock, Pa., just southeast of Pittsburgh. He was 81, and had been in the air conditioning and plumbing business in nearby McKeesport. If you had seen him on the street he would probably have looked to you like so many other graying, bespectacled old World War II veterans whose names appear so of … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

How “gay marriage” passed in Republican-controlled NY Senate

June 28, 2011 Leave a comment

It was arguably the biggest sell-out in modern American political history. A group of “pro-family” Republican Senators who already had the power to stop “gay marriage” in New York decided to take the easy route, and simply stepped back and gave in to their opponents.

As expected, there were immediate calls for Dean Skelos (at the very least) to resign as Republican Majority Leader, as the primary individual responsible for the bill’s passage.

In any case, this is a painful lesson for all of us about trusting “pro-family” politicians — and a loud wake-up call about the anti-family direction of the Republican Party. We’ve seen it in Massachusetts and other states over the last few years. We’d all better “get it” before it’s too late.

(Excerpt) Read more at massresistance.org …

via How “gay marriage” passed in Republican-controlled NY Senate.

In Defense Of Our Constitution

June 28, 2011 Leave a comment

Richard Stengel is lauded by the political left as a smart and knowlegeable reporter, and is well thought of as Editor of Time Magazine.

After this week’s edition, one has to wonder why.

Time’s headline story is titled, “Does It Still Matter?’. It refers to the U.S. Constitution. And in large part, Stengel’s answer is “No”. In fact, he basically argues that it never mattered.

Stengel points to the irrelevancy of the Constitution is pointing to war powers. He goes on:

Stengel’s most relevant passage states the following:

“We can pat ourselves on the back about the past 223 years, but we cannot led the Constitution become an obstacle to the U.S.’s moving into the future with a sensible health care system, a globalized economy, an evolving sense of civil and political rights

…The Constitution does not protect our spirit of liberty; our spirit of liberty protects the Constitution. The Constitution serves the nation; the nation does not serve the Constitution.”

These passages, more than any other, show Stengel’s bias, and in the end, his ultimate stupidity. The Constitution does protect our spirit of liberty, in so far that without such a document, what would we define as liberty? Would we, for example, simply inherently understand that free speech is a right, without such a declaration as the first amendment? The Constitution serves our nation, to be sure; but a nation which does not serve the Constitution is abiding by what law, exactly?

(Excerpt) Read more at neoavatara.com …

via In Defense Of Our Constitution.

Obama Regime Rigged “Don’t Ask, Don’t Tell” Survey Results!

June 28, 2011 Leave a comment

Defense Department Inspector General Says, The Fix Was In…

DADT Survey Results Written BEFORE Survey Taken!

In a 33 page report by Inspector General, Department of Defense, obtained by WND and reported today, “Feds Find Fix Was in on ‘Study’ of Homosexuality in Ranks,” concludes that “the fix – maybe even handed down by the White House – was in before the military ever started asking soldiers and sailors about how opening the ranks to homosexuals would affect the nation’s defense.”

If you will remember the Democrats, having suffered extreme losses during the mid-term elections, were ramming through legislation during the Lame Duck Session before their representative’s terms were up. One of those laws was the repeal of the “Don’t Ask, Don’t Tell” policy established during Bill Clinton’s term in office in 1993 that prohibited homosexuals from serving in the armed forces. There was little debate, and few hearings on the subject as both the Democrat led House and the Senate pushed the legislation through. One of their key arguments relied on the “Survey.” It now appears that Congress was duped and the information misrepresented about this survey. The report is also showing that an unknown person leaked unauthorized information to the media.

via Obama Regime Rigged “Don’t Ask, Don’t Tell” Survey Results!.

Ann Coulter: GOP Should Hide Their Candidates So Media Can’t ‘Ridicule And Demonize’ Them

June 28, 2011 Leave a comment

Ann Coulter appeared on Fox Business Network’s America’s Nightly Scoreboard with some advice for Republican primary voters. Coulter told them they “need to concentrate on Governors” in the race, because even though she likes Michele Bachmann and Herman Cain a lot, she doesn’t think either have the necessary credentials or experience to go all the way. Coulter also spent some describing how environmental groups are “fanatics” and wondered “couldn’t we save a lot of money getting rid of the EPA?” Yet her harshest remarks were saved for the mainstream media, as she

(Excerpt) Read more at mediaite.com …

via Ann Coulter: GOP Should Hide Their Candidates So Media Can’t ‘Ridicule And Demonize’ Them.

Bachmann’s Former Chief of Staff: She Isn’t Ready

June 28, 2011 Leave a comment

In today’s issue of the Des Moines Register, Ron Carey, former chief of staff to Michele Bachmann, says that she isn’t ready for the White House. He also endorsed one of her rivals for the GOP nomination:

Having seen the two of them, up close and over a long period of time, it is clear to me that while Tim Pawlenty possesses the judgment, the demeanor, and the readiness to serve as president, Michele Bachmann decidedly does not.

The Bachmann campaign and congressional offices I inherited were wildly out of control. Stacks upon stacks of unopened contributions filled the campaign office while thousands of communications from citizens waited for an answer. If she is unable, or unwilling, to handle the basic duties of a campaign or congressional office, how could she possibly manage the magnitude of the presidency?

Does anyone else find that to be a notably weak takedown? It’s never a good thing when someone who has observed you closely votes “no confidence,” so file that away for what it’s worth. But the particulars of this op-ed? Think about it. What does a good leader do when folks in the office are getting behind on the mail and correspondence? I’d say that hiring a new chief of staff is an acceptable answer. Sounds like that’s what Rep. Bachmann did. I could write a better takedown of former colleagues who I found to be totally wonderful and qualified in every way!

I am prepared to believe that Bachmann is unfit for the presidency. In fact, I already believe it, for reasons alluded to here.

(Excerpt) Read more at theatlantic.com …

via Bachmann’s Former Chief of Staff: She Isn’t Ready.

Bachmann stands by claims that ‘Founding Fathers’ ended slavery | Raw Replay

June 28, 2011 Leave a comment

keithworstpersons-screengrab Nation

khmerrougecore0627 World

babykoala-scrrencap Science/Tech

smoking0627 Biz/Money

stewartwallace-screengrab Political Satire/Parody

betawardschangedmylife-screencap Culture

bachmannstephanopoulosinterview-screencap Say What?

nation_pmr_activist_110628a Activism

Bachmann stands by claims that ‘Founding Fathers’ ended slavery

* Posted on 06.28.11

* By Kase Wickman

* Categories: Featured, Say What?

Rep. Michele Bachmann, who officially announced yesterday in Iowa that she is running for president, appeared on “Good Morning America” Monday, where George Stephanopoulos attempted to clarify some of her previous statements.

Among them: Bachmann’s claim that “the Founding Fathers who wrote the Constitution and the Declaration of Independence worked tirelessly to end slavery.”

“Now with respect, Congresswoman, that’s just not true,” Stephanopoulos said. “Many of them including Jefferson and Washington were actually slave holders and slavery didn’t end until the Civil War.”

Bachmann dodged the question, answering, “Well, you know what’s marvelous is that in this country and under our Constitution, we have the ability when we recognize that something is wrong to change it. And that’s what we did in our country. We changed it. We no longer have slavery. That’s a good thing. And what our Constitution has done for our nation, is to give us the basis of freedom unparalleled in the rest of the world.”

She goes on to claim that John Quincy Adams, who was a small boy during the Revolutionary War and did indeed eventually work to abolish slavery, should be counted as a “Founding Father.”

via Bachmann stands by claims that ‘Founding Fathers’ ended slavery | Raw Replay.

Time Magazine’s Buffoonery Exposed

June 28, 2011 Leave a comment

Let’s face the ugly truth: there is a movement in this country to diminish the weight of the United States Constitution, the very basis of our liberties and the most successful framework of governance int he history of mankind. It stands in the way of the dreams of statists, and for that reason, is under attack.

The latest journalistic assault on the Constitution came from Richard Stengel, managing editor of Time Magazine, in a cover story (!) last week, that was nothing less than disgraceful and laughable. Mark J, Fitzgibbons wrote a quick blog for AT debunking the story, but now on Patterico‘s Pontifications comes a more thorough and absolutely devastating essay by Richard Worthing, “Thirteen Clear Factual Errors in Richard Stengel’s Essay on the Constitution”

The logic and evidence are impeccable. read, enjoy, and pass along the essay. Time Magazine has descended to the level of intellectual buffoonery. An already fading jorunalistic institution can be said to be in its moral death throes, publishing tripe like this. Stengel deserves all the scorn that thinking people can dish out.

See also: A Man and a Message Whose Time Has Come

via Time Magazine’s Buffoonery Exposed.

The man who can bring down the Obama regime

June 28, 2011 Leave a comment

In April of 2009, Barack Obama named Kenneth Melson acting director of the Bureau of Alcohol, Tobacco and Firearms. Today, this attorney and longtime bureaucrat possesses information which could bring down A.G. Eric Holder and perhaps Barack Obama himself.

As head of the ATF it was Melson who oversaw the Fast and Furious project, begun only a few months after his appointment and now responsible for the sale of more than 2000 weapons to straw purchasers for Mexican drug cartels.

He helped facilitate the “walking” of these guns across the Mexican border, instructing agents to not interfere with the process. He even watched closed circuit broadcasts of US border state gun dealers illegally transferring dozens of weapons to criminal buyers at the instruction of his agency.

After ATF agent and whistle blower John Dodson testified to members of Charles Grassley‘s Senate Judiciary Committee, Melson provided cover for his bosses at the Justice Department and the White House by saying nothing and providing nothing but denials in response to Grassley’s demands for information.

But as the ATF’s Project Gunrunner, or “Gunwalker” as it is more rightly called and its Phoenix, sister operation, Fast and Furious have become better known, dragging Eric Holder before Congressional Committees and forcing employees of his agency to explain their responsibility in the deaths of American agents, Ken Melson has become a liability to those who selected him and his days at the ATF appear numbered.

Nevertheless, there is more to the “Gunwalker” story and its continued cover up than apparent blind loyalty shown by a Regime subordinate to his bosses.

Around the time Ken Melson was made Acting ATF Director and just before thousands of guns began briskly “walking” to Mexico

Melson was named co-chair of the NEWLY CHARTERED…

via The man who can bring down the Obama regime.

The Peronist in the White House

June 28, 2011 Leave a comment

Obama is a Marxist,” Mark Levin, my favorite talk-show host, proclaims. Levin is probably the smartest guy on radio. But when it comes to Obama, even this smart guy doesn’t quite get it.

Obama is not a Marxist. He is a fascist of the left, a Peronist. And that is not an academic hair split. To understand this distinction is to understand what Obama is and why he is so dangerous.

Since the seating of the Estates General on the eve of the French Revolution, the terms right and left have been synonymous with the social basis of politics, the idea that generally there is a relationship between one’s place in the class system and one’s allegiance to a political party.

But what if the extremes of politics could be further partitioned according to their social base? The distinguished political scientist Seymour Martin Lipset took fascism and divided into right, left, and center, depending on from which social elements a fascist party drew its support.

via The Peronist in the White House.

YouTube – Judge Napolitano: (This Video and MORE!) ~ Why The Patriot Act is Unconstitutional. (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

YouTube – Judge Napolitano: Why The Patriot Act is Unconstitutional. YouTube – Judge Napolitano: Why The Patriot Act is Unconstitutional.: "Judge Napolitano: Why The Patriot Act is Unconstitutional." Posted by Gunny G at Monday, June 27, 2011 via BLOGGER.GUNNY.G.1984(+): YouTube – Judge Napolitano: Why The Patriot Act is Unconstitutional.. … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

And So It Goes | Eyes on Washington.com

June 28, 2011 Leave a comment

(Excerpt)

And So It Goes

By admin ~ June 23rd, 2011 @ 10:53

By Aaron Cantor USAF (ret) ©

A friend and fellow blogger sent me an interesting article which I will include here.

In 1887 Alexander Tyler, a Scottish history professor at the University of

Edinborough, had this to say about the fall of the Athenian Republic some

2,000 years prior:

“A democracy is always temporary in nature; it simply cannot exist as a permanent form of government.

A democracy will continue to exist up until the time that voters discover that they can vote themselves generous gifts

from the public treasury.

From that moment on, the majority always votes for

the candidates who promise the most benefits from the public treasury, with the result that every democracy will finally collapse over loose fiscal policy, (which is) always followed by a dictatorship.”

“The average age of the world’s greatest civilizations from the beginning of history, has been about 200 years. During those 200 years, these nations always progressed through the following sequence:

“From bondage to spiritual faith; From spiritual faith to great courage; From courage to liberty; From liberty to abundance; From abundance to complacency; From complacency to apathy; From apathy to dependence; From dependence back into bondage.”

The Obituary follows:

The United States of America

Born 1776 Died 2008

Cause of Death: Political Suicide

via And So It Goes | Eyes on Washington.com.

DoD Civilian Expeditionary Workforce (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

DoD Civilian Expeditionary Workforce email received this morning | 10/20/2009 | Dmitry Levin Posted on Tuesday, October 20, 2009 7:40:25 AM by IbJensen Senator Obama was nearly 17 minutes into his July 2, 2008, speech in Colorado Springs, Colorado when he deviated from his pre-released script and performed without the teleprompter net saying: "We cannot continue to rely on our military in order to achieve the national security objectives that we' … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

IS THE US GOVERNMENT PREPARING TO SEND DISSENTERS TO PRISON CAMPS? (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

IS THE US GOVERNMENT PREPARING TO SEND DISSENTERS TO PRISON CAMPS? IS THE US GOVERNMENT PREPARING TO SEND DISSENTERS TO PRISON CAMPS? By NWV News writer Jim Kouri Posted 1:00 AM Eastern February 5, 2009 © NewsWithViews.com Within the last few weeks since Americans witnessed the transition between a Bush Administration to an Obama Administration, some conservatives have noticed an escalation in using the US military and military-style tactics to deal with "national security concerns." Such actions include use of … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Michelle For President? No, Not That Michelle (Gulp!)

June 28, 2011 Leave a comment

If this doesn’t scare you then you’re not paying attention. Michael Medved, a conservative talker, explores the idea that even if Barack Obama loses in 2012, why he could all ways run again in four years. And if he wins his wife could always run in years. If the left is trying to scare the crap out of us, it worked.

Can’t say we weren’t warned. I just didn’t think it would become SOP for the lefties. Bill Clinton warned us in 1992 when you elect him you get a co-presidency. Hillary comes along with the package. Now it appears that’s standard operating procedure in the Democratic Party: the lefty wife comes along as part of the lefty Presidential package. Geeze, and they say the Republican bench is thin.

(Excerpt) Read more at radioviceonline.com …

via Michelle For President? No, Not That Michelle (Gulp!).

Follow

Get every new post delivered to your Inbox.

Join 268 other followers