Archive

Archive for June 28, 2011

Ancient stones a mystery for archeologists, scientists [ Los Lunas Decalogue ]

June 28, 2011 Leave a comment

.if they had the means to explore various parts of Europe and Asia by boat, then they certainly had the means to cross the seas to the Americas.

One such item of interest is a large stone that was found in a dry creek bed in New Mexico. This stone discovered by early explorers contains the entire Ten Commandments written in Ancient Hebrew script. Today, this large stone still lies where it was originally found in the early 1800′s on the side of Hidden Mountain near Los Lunas, New Mexico, about thirty-five miles south of Albuquerque.

Scholars who have studied the stone say it pre-dates the arrival of Columbus to America.

How did this large stone with the Ten Commandments written in Ancient Hebrew come to be in North America? No one has an answer.

Another item that shows strong evidence of the possibility of Hebrews in America is noted in a custom celebrated by the Yuchi Indians in Oklahoma.

The Yuchis originally migrated from the Bahamas to Florida and Georgia and then later to the Oklahoma territory.

(Excerpt) Read more at yourhoustonnews.com …

via Ancient stones a mystery for archeologists, scientists [ Los Lunas Decalogue ].

Why Barack H. Obama Jr. Is Not Eligible To Be President| The Post & Email

June 28, 2011 Leave a comment

AND IS NOT PRESIDENT OF THESE UNITED STATES OF AMERICA

by Donald R. Laster Jr., ©2011

The lawsuit Purpura v. Sebelius claims that the health care law signed last year violates the U.S. Constitution and that the person having signed it is an imposter president

(Jun. 28, 2011) — Editor’s Note: The following document is part of the appendix in the case Purpura v. Sebelius, which claims that the Patient Protection and Accountability Act is unconstitutional and that Obama is not eligible to serve as president.

The Post & Email covered the case here and here, and it has been covered extensively at Conservative News and Views.

The Jersey Shore Tea Party is a plaintiff in the case, as are many other organizations and individuals. Fifteen constitutional violations have been cited as reasons for the legislation to be vacated. The 15th item claims that the bill violates the Tenth Amendment of the Bill of Rights, which the U. S. Supreme Court recently ruled takes precedence over federal law in keeping with the Framers’ concept of federalism.

via Why Barack H. Obama Jr. Is Not Eligible To Be President| The Post & Email.

http://www.thepostemail.com/2011/06/28/why-barack-h-obama-jr-is-not-eligible-to-be-president/

Estulin: Elitists Consider Assassinating Ron Paul (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 1 comment

Estulin: Elitists Consider Assassinating Ron Paul Estulin: Elitists Consider Assassinating Ron Paul Best-selling author and Bilderberg sleuth says intelligence sources told him highest levels of U.S. government discussing what result would be if Congressman was killed Paul Joseph Watson Prison Planet Friday, December 14, 2007 Best-selling author and Bilderberg sleuth Daniel Estulin says he has received information from sources inside the U.S. int … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Gunny G: A Most Amazing Story, From “Sully” (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

Piggyback Hero by Ralph Kenney Bennett Tomorrow they will lay the remains of Glenn Rojohn to rest in the Peace Lutheran Cemetery in the little town of Greenock, Pa., just southeast of Pittsburgh. He was 81, and had been in the air conditioning and plumbing business in nearby McKeesport. If you had seen him on the street he would probably have looked to you like so many other graying, bespectacled old World War II veterans whose names appear so of … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

How “gay marriage” passed in Republican-controlled NY Senate

June 28, 2011 Leave a comment

It was arguably the biggest sell-out in modern American political history. A group of “pro-family” Republican Senators who already had the power to stop “gay marriage” in New York decided to take the easy route, and simply stepped back and gave in to their opponents.

As expected, there were immediate calls for Dean Skelos (at the very least) to resign as Republican Majority Leader, as the primary individual responsible for the bill’s passage.

In any case, this is a painful lesson for all of us about trusting “pro-family” politicians — and a loud wake-up call about the anti-family direction of the Republican Party. We’ve seen it in Massachusetts and other states over the last few years. We’d all better “get it” before it’s too late.

(Excerpt) Read more at massresistance.org …

via How “gay marriage” passed in Republican-controlled NY Senate.

In Defense Of Our Constitution

June 28, 2011 Leave a comment

Richard Stengel is lauded by the political left as a smart and knowlegeable reporter, and is well thought of as Editor of Time Magazine.

After this week’s edition, one has to wonder why.

Time’s headline story is titled, “Does It Still Matter?’. It refers to the U.S. Constitution. And in large part, Stengel’s answer is “No”. In fact, he basically argues that it never mattered.

Stengel points to the irrelevancy of the Constitution is pointing to war powers. He goes on:

Stengel’s most relevant passage states the following:

“We can pat ourselves on the back about the past 223 years, but we cannot led the Constitution become an obstacle to the U.S.’s moving into the future with a sensible health care system, a globalized economy, an evolving sense of civil and political rights

…The Constitution does not protect our spirit of liberty; our spirit of liberty protects the Constitution. The Constitution serves the nation; the nation does not serve the Constitution.”

These passages, more than any other, show Stengel’s bias, and in the end, his ultimate stupidity. The Constitution does protect our spirit of liberty, in so far that without such a document, what would we define as liberty? Would we, for example, simply inherently understand that free speech is a right, without such a declaration as the first amendment? The Constitution serves our nation, to be sure; but a nation which does not serve the Constitution is abiding by what law, exactly?

(Excerpt) Read more at neoavatara.com …

via In Defense Of Our Constitution.

Obama Regime Rigged “Don’t Ask, Don’t Tell” Survey Results!

June 28, 2011 Leave a comment

Defense Department Inspector General Says, The Fix Was In…

DADT Survey Results Written BEFORE Survey Taken!

In a 33 page report by Inspector General, Department of Defense, obtained by WND and reported today, “Feds Find Fix Was in on ‘Study’ of Homosexuality in Ranks,” concludes that “the fix – maybe even handed down by the White House – was in before the military ever started asking soldiers and sailors about how opening the ranks to homosexuals would affect the nation’s defense.”

If you will remember the Democrats, having suffered extreme losses during the mid-term elections, were ramming through legislation during the Lame Duck Session before their representative’s terms were up. One of those laws was the repeal of the “Don’t Ask, Don’t Tell” policy established during Bill Clinton’s term in office in 1993 that prohibited homosexuals from serving in the armed forces. There was little debate, and few hearings on the subject as both the Democrat led House and the Senate pushed the legislation through. One of their key arguments relied on the “Survey.” It now appears that Congress was duped and the information misrepresented about this survey. The report is also showing that an unknown person leaked unauthorized information to the media.

via Obama Regime Rigged “Don’t Ask, Don’t Tell” Survey Results!.

Ann Coulter: GOP Should Hide Their Candidates So Media Can’t ‘Ridicule And Demonize’ Them

June 28, 2011 Leave a comment

Ann Coulter appeared on Fox Business Network’s America’s Nightly Scoreboard with some advice for Republican primary voters. Coulter told them they “need to concentrate on Governors” in the race, because even though she likes Michele Bachmann and Herman Cain a lot, she doesn’t think either have the necessary credentials or experience to go all the way. Coulter also spent some describing how environmental groups are “fanatics” and wondered “couldn’t we save a lot of money getting rid of the EPA?” Yet her harshest remarks were saved for the mainstream media, as she

(Excerpt) Read more at mediaite.com …

via Ann Coulter: GOP Should Hide Their Candidates So Media Can’t ‘Ridicule And Demonize’ Them.

Bachmann’s Former Chief of Staff: She Isn’t Ready

June 28, 2011 Leave a comment

In today’s issue of the Des Moines Register, Ron Carey, former chief of staff to Michele Bachmann, says that she isn’t ready for the White House. He also endorsed one of her rivals for the GOP nomination:

Having seen the two of them, up close and over a long period of time, it is clear to me that while Tim Pawlenty possesses the judgment, the demeanor, and the readiness to serve as president, Michele Bachmann decidedly does not.

The Bachmann campaign and congressional offices I inherited were wildly out of control. Stacks upon stacks of unopened contributions filled the campaign office while thousands of communications from citizens waited for an answer. If she is unable, or unwilling, to handle the basic duties of a campaign or congressional office, how could she possibly manage the magnitude of the presidency?

Does anyone else find that to be a notably weak takedown? It’s never a good thing when someone who has observed you closely votes “no confidence,” so file that away for what it’s worth. But the particulars of this op-ed? Think about it. What does a good leader do when folks in the office are getting behind on the mail and correspondence? I’d say that hiring a new chief of staff is an acceptable answer. Sounds like that’s what Rep. Bachmann did. I could write a better takedown of former colleagues who I found to be totally wonderful and qualified in every way!

I am prepared to believe that Bachmann is unfit for the presidency. In fact, I already believe it, for reasons alluded to here.

(Excerpt) Read more at theatlantic.com …

via Bachmann’s Former Chief of Staff: She Isn’t Ready.

Bachmann stands by claims that ‘Founding Fathers’ ended slavery | Raw Replay

June 28, 2011 Leave a comment

keithworstpersons-screengrab Nation

khmerrougecore0627 World

babykoala-scrrencap Science/Tech

smoking0627 Biz/Money

stewartwallace-screengrab Political Satire/Parody

betawardschangedmylife-screencap Culture

bachmannstephanopoulosinterview-screencap Say What?

nation_pmr_activist_110628a Activism

Bachmann stands by claims that ‘Founding Fathers’ ended slavery

* Posted on 06.28.11

* By Kase Wickman

* Categories: Featured, Say What?

Rep. Michele Bachmann, who officially announced yesterday in Iowa that she is running for president, appeared on “Good Morning America” Monday, where George Stephanopoulos attempted to clarify some of her previous statements.

Among them: Bachmann’s claim that “the Founding Fathers who wrote the Constitution and the Declaration of Independence worked tirelessly to end slavery.”

“Now with respect, Congresswoman, that’s just not true,” Stephanopoulos said. “Many of them including Jefferson and Washington were actually slave holders and slavery didn’t end until the Civil War.”

Bachmann dodged the question, answering, “Well, you know what’s marvelous is that in this country and under our Constitution, we have the ability when we recognize that something is wrong to change it. And that’s what we did in our country. We changed it. We no longer have slavery. That’s a good thing. And what our Constitution has done for our nation, is to give us the basis of freedom unparalleled in the rest of the world.”

She goes on to claim that John Quincy Adams, who was a small boy during the Revolutionary War and did indeed eventually work to abolish slavery, should be counted as a “Founding Father.”

via Bachmann stands by claims that ‘Founding Fathers’ ended slavery | Raw Replay.

Time Magazine’s Buffoonery Exposed

June 28, 2011 Leave a comment

Let’s face the ugly truth: there is a movement in this country to diminish the weight of the United States Constitution, the very basis of our liberties and the most successful framework of governance int he history of mankind. It stands in the way of the dreams of statists, and for that reason, is under attack.

The latest journalistic assault on the Constitution came from Richard Stengel, managing editor of Time Magazine, in a cover story (!) last week, that was nothing less than disgraceful and laughable. Mark J, Fitzgibbons wrote a quick blog for AT debunking the story, but now on Patterico‘s Pontifications comes a more thorough and absolutely devastating essay by Richard Worthing, “Thirteen Clear Factual Errors in Richard Stengel’s Essay on the Constitution”

The logic and evidence are impeccable. read, enjoy, and pass along the essay. Time Magazine has descended to the level of intellectual buffoonery. An already fading jorunalistic institution can be said to be in its moral death throes, publishing tripe like this. Stengel deserves all the scorn that thinking people can dish out.

See also: A Man and a Message Whose Time Has Come

via Time Magazine’s Buffoonery Exposed.

The man who can bring down the Obama regime

June 28, 2011 1 comment

In April of 2009, Barack Obama named Kenneth Melson acting director of the Bureau of Alcohol, Tobacco and Firearms. Today, this attorney and longtime bureaucrat possesses information which could bring down A.G. Eric Holder and perhaps Barack Obama himself.

As head of the ATF it was Melson who oversaw the Fast and Furious project, begun only a few months after his appointment and now responsible for the sale of more than 2000 weapons to straw purchasers for Mexican drug cartels.

He helped facilitate the “walking” of these guns across the Mexican border, instructing agents to not interfere with the process. He even watched closed circuit broadcasts of US border state gun dealers illegally transferring dozens of weapons to criminal buyers at the instruction of his agency.

After ATF agent and whistle blower John Dodson testified to members of Charles Grassley‘s Senate Judiciary Committee, Melson provided cover for his bosses at the Justice Department and the White House by saying nothing and providing nothing but denials in response to Grassley’s demands for information.

But as the ATF’s Project Gunrunner, or “Gunwalker” as it is more rightly called and its Phoenix, sister operation, Fast and Furious have become better known, dragging Eric Holder before Congressional Committees and forcing employees of his agency to explain their responsibility in the deaths of American agents, Ken Melson has become a liability to those who selected him and his days at the ATF appear numbered.

Nevertheless, there is more to the “Gunwalker” story and its continued cover up than apparent blind loyalty shown by a Regime subordinate to his bosses.

Around the time Ken Melson was made Acting ATF Director and just before thousands of guns began briskly “walking” to Mexico

Melson was named co-chair of the NEWLY CHARTERED…

via The man who can bring down the Obama regime.

The Peronist in the White House

June 28, 2011 Leave a comment

Obama is a Marxist,” Mark Levin, my favorite talk-show host, proclaims. Levin is probably the smartest guy on radio. But when it comes to Obama, even this smart guy doesn’t quite get it.

Obama is not a Marxist. He is a fascist of the left, a Peronist. And that is not an academic hair split. To understand this distinction is to understand what Obama is and why he is so dangerous.

Since the seating of the Estates General on the eve of the French Revolution, the terms right and left have been synonymous with the social basis of politics, the idea that generally there is a relationship between one’s place in the class system and one’s allegiance to a political party.

But what if the extremes of politics could be further partitioned according to their social base? The distinguished political scientist Seymour Martin Lipset took fascism and divided into right, left, and center, depending on from which social elements a fascist party drew its support.

via The Peronist in the White House.

YouTube – Judge Napolitano: (This Video and MORE!) ~ Why The Patriot Act is Unconstitutional. (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

YouTube – Judge Napolitano: Why The Patriot Act is Unconstitutional. YouTube – Judge Napolitano: Why The Patriot Act is Unconstitutional.: "Judge Napolitano: Why The Patriot Act is Unconstitutional." Posted by Gunny G at Monday, June 27, 2011 via BLOGGER.GUNNY.G.1984(+): YouTube – Judge Napolitano: Why The Patriot Act is Unconstitutional.. … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

And So It Goes | Eyes on Washington.com

June 28, 2011 Leave a comment

(Excerpt)

And So It Goes

By admin ~ June 23rd, 2011 @ 10:53

By Aaron Cantor USAF (ret) ©

A friend and fellow blogger sent me an interesting article which I will include here.

In 1887 Alexander Tyler, a Scottish history professor at the University of

Edinborough, had this to say about the fall of the Athenian Republic some

2,000 years prior:

“A democracy is always temporary in nature; it simply cannot exist as a permanent form of government.

A democracy will continue to exist up until the time that voters discover that they can vote themselves generous gifts

from the public treasury.

From that moment on, the majority always votes for

the candidates who promise the most benefits from the public treasury, with the result that every democracy will finally collapse over loose fiscal policy, (which is) always followed by a dictatorship.”

“The average age of the world’s greatest civilizations from the beginning of history, has been about 200 years. During those 200 years, these nations always progressed through the following sequence:

“From bondage to spiritual faith; From spiritual faith to great courage; From courage to liberty; From liberty to abundance; From abundance to complacency; From complacency to apathy; From apathy to dependence; From dependence back into bondage.”

The Obituary follows:

The United States of America

Born 1776 Died 2008

Cause of Death: Political Suicide

via And So It Goes | Eyes on Washington.com.

DoD Civilian Expeditionary Workforce (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

DoD Civilian Expeditionary Workforce email received this morning | 10/20/2009 | Dmitry Levin Posted on Tuesday, October 20, 2009 7:40:25 AM by IbJensen Senator Obama was nearly 17 minutes into his July 2, 2008, speech in Colorado Springs, Colorado when he deviated from his pre-released script and performed without the teleprompter net saying: "We cannot continue to rely on our military in order to achieve the national security objectives that we' … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

IS THE US GOVERNMENT PREPARING TO SEND DISSENTERS TO PRISON CAMPS? (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

IS THE US GOVERNMENT PREPARING TO SEND DISSENTERS TO PRISON CAMPS? IS THE US GOVERNMENT PREPARING TO SEND DISSENTERS TO PRISON CAMPS? By NWV News writer Jim Kouri Posted 1:00 AM Eastern February 5, 2009 © NewsWithViews.com Within the last few weeks since Americans witnessed the transition between a Bush Administration to an Obama Administration, some conservatives have noticed an escalation in using the US military and military-style tactics to deal with "national security concerns." Such actions include use of … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Michelle For President? No, Not That Michelle (Gulp!)

June 28, 2011 Leave a comment

If this doesn’t scare you then you’re not paying attention. Michael Medved, a conservative talker, explores the idea that even if Barack Obama loses in 2012, why he could all ways run again in four years. And if he wins his wife could always run in years. If the left is trying to scare the crap out of us, it worked.

Can’t say we weren’t warned. I just didn’t think it would become SOP for the lefties. Bill Clinton warned us in 1992 when you elect him you get a co-presidency. Hillary comes along with the package. Now it appears that’s standard operating procedure in the Democratic Party: the lefty wife comes along as part of the lefty Presidential package. Geeze, and they say the Republican bench is thin.

(Excerpt) Read more at radioviceonline.com …

via Michelle For President? No, Not That Michelle (Gulp!).

BLOGGER.GUNNY.G.1984(+): Gunny G: Good Quote by Ron Paul…

June 28, 2011 Leave a comment

Gunny G: Good Quote by Ron Paul

Gunny G: Good Quote by Ron Paul…

In a United States so locked into a ‘march step’ mentality among its War Leaders, and Politicians, in leading their citizens into further expansion of their World War, Congressman Paul ‘crossed the line’, according to Russian Political Scientists, when he recently stated upon the floor of the United Congress:

“Patriotism is more closely linked to dissent than it is to conformity and a blind desire for safety and security. Understanding the magnificent rewards of a free society makes us unbashful in its promotion, fully realizing that maximum wealth is created and the greatest chance for peace comes from a society respectful of individual liberty”.

Read more »

http://gunnyg.blogspot.com/2011/05/congressman-ron-paul-targeted-for.html

**********

via BLOGGER.GUNNY.G.1984(+): Gunny G: Good Quote by Ron Paul….

Beck and Family Harassed During Outdoor Movie Night in NYC Park

June 28, 2011 1 comment

There are those who love freedom of expression, as long as it’s not conservatives who are doing the expressing. Just ask Glenn Beck. On radio Tuesday, he told the stunning story of how he and his family were harassed during an outdoor movie in New York City’s Bryant Park.

For those unfamiliar with Bryant Park, it hosts weekly showings of classic films during the summer months. Attendees bring blankets and picnic dinners and sprawl out on the park’s great lawn while watching the films on a giant screen.

As Beck explained, he attended Monday night‘s public showing of Alfred Hitchcock’s “The 39 Steps” with his wife and daughter. During the film, he was ridiculed, had someone “kick a cup” of wine on his wife and on his blanket, and even witnessed another person stand up and yell, “We hate conservatives here!”

“These people were some of the most hateful people I have ever seen,” Beck said. “All I wanted to do is go out on a blanket with my family and have dinner in the afternoon sun and sit around Americans, not like-minded Americans, and just watch a movie in the park. And last night at about‑‑ when the movie was just about over, my wife and I got out because it was hostile.”

Later, when Beck left near the end of the movie, the crowd applauded.

(Excerpt) Read more at theblaze.com

via Beck and Family Harassed During Outdoor Movie Night in NYC Park.

Gettysburg College’s Hate Crime ‘Artist’ by Thomas DiLorenzo

June 28, 2011 Leave a comment

A man from Detroit named John Sims, who now teaches art at the Ringling [Brothers?] School of Art and Design in Sarasota, Florida, has created quite a controversy with his planned September 3, 2004 opening of an exhibit at Gettysburg College where he will reportedly “lynch” the Confederate Battle Flag by “hanging” it from a gallows. (In another work of “art” Sims has crudely insulted every Jew in the world by displaying the Israeli flag in the colors of the PLO). Gettysburg College’s museum director, Molly Hutton, reportedly jumped at the chance to display something as politically correct as the Israeli flag smear when Sims proposed his “lynching” exhibit at the College.

This is yet another example of the incredible — if not astounding — ignorance of American history on the part of most Americans — even ones who are employed by institutions of higher learning. Having written a book on Lincoln, published over 80 articles, and given dozens of public lectures and radio interviews on Lincoln and the War to Prevent Southern Independence over the past two-and-a-half years, one thing I have learned is that the average American knows nothing at all about the topic except for a few clichés that he or she was exposed to in primary school.

Southern heritage groups — whose members are infinitely better educated on this topic than the average American is

via Gettysburg College’s Hate Crime ‘Artist’ by Thomas DiLorenzo.

Cancer Surges In Body Scanner Operators; TSA Launches Cover-Up

June 28, 2011 Leave a comment

Fearful of provoking further public resistance to naked airport body scanners, the TSA has been caught covering up a surge in cases of TSA workers developing cancer as a result of their close proximity to radiation-firing devices, perhaps the most shocking revelation to emerge from the latest FOIA documents obtained by the Electronic Privacy Information Center.

via Cancer Surges In Body Scanner Operators; TSA Launches Cover-Up.

BLOGGER.GUNNY.G.1984(+): Gunny G: U. S. Constitution Apparently NOT All It’s Cracked Up To Be?….

June 28, 2011 Leave a comment

Marxism in America

June 28, 2011 2 comments

This is a 6 minute speak by the General regarding the bad road this country is going down under the present Administration. This guy is definitely one of us. I’m taking his advice and looking into his organization.

via Marxism in America.

The Real DiLorenzo: A ‘Southern Partisan’ Interview

June 28, 2011 Leave a comment

Why has the reaction of the critics been so severe?

The nationally syndicated columnist, Paul Criag Roberts wrote to me and said, “They’re attacking you because you’re destroying their human capital.” What he meant by that is that there are academics who have spent careers writing fables and fairytales about Abraham Lincoln. Then I come along and do my best to present real facts and portray Abraham Lincoln as a real life human being, not as a saint. It threatens their whole veracity.

The very first e-mail I got was from a philosophy professor at Gettysburg College. He congratulated me and told me that in his opinion, “You’ve overthrown the myth about a real legend.” And he said his colleague, Gabor Boritt, is not going to like it at all.

I quote Gabor Boritt commenting on Lincoln’s career-long infatuation with colonization, or shipping all the black people back to Africa or Haiti or South America or someplace. I quoted Boritt as saying, “This is how honest people lie.” In other words, all those statements about colonization were honest lies. If that’s not Orwellian, what is?

In a sense, you’re not attacking Lincoln, so much as the very foundations of modernAmerican national government.

I call him the Founding Father of big government. It’s kind of strange. There are these self-described conservatives who are the big Lincoln idolaters, like the people at the Claremont Institute. But really, when you look at them, they advocate nationalism and executive power. That’s one reason why they idolize him so much. That’s totally at odds with the Jeffersonian tradition.

On the other side of the coin are the liberal historians. Liberals always have Lincoln and FDR as their number one and number two presidents, because they were the most dictatorial of all our presidents. So, you have this odd mix of liberal and conservative academics, both of whom idolize Lincoln because they really do embrace big government.

Big government conservatives don’t mind big government as long as people like themselves are in charge of it. They run the Bush administration, at the moment.

via The Real DiLorenzo: A ‘Southern Partisan’ Interview.

Media Matters Has A FOX News ‘War Room’ That Operates 20 Hours A Day

June 28, 2011 2 comments

Any remaining doubt that Media Matters reason-for-being is to take down FOX News? Check this out. Turns out the progressive, non-profit watch dog website has a FOX News “war room” that operates in four separate shifts from the hours of 5am to 1am. According to FishbowlDC, they employ specific teams that focus on Glenn Beck‘s radio and television show. Considering those folks will be out of a job come the end of the week — Beck‘s last show is Friday — and Media Matters

(Excerpt) Read more at businessinsider.com …

via Media Matters Has A FOX News ‘War Room’ That Operates 20 Hours A Day.

Cain: Obama Wants Economic Worsening In Order to Raise Taxes

June 28, 2011 Leave a comment

Republican presidential candidate Herman Cain blasted President Obama for his handling of the economy in a Fox and Friends appearance Tuesday morning, accusing Obama and Democrats of wanting a bigger economic crisis so they could raise taxes.

“I predicted this nine months ago, quite frankly, that that was the game plan,” he said.

Cain also said the impasse over the deficit-reduction talks is a result of Obama failing to lead. Cain’s solution? Prioritize paying interest on the debt, military salaries, Social Security and Medicare bills, and then put everything else on the table for “dramatic cuts.”

His plan for the economy, he said, included capping taxes on corporate profits and individuals at 25 percent, suspending taxes on repatriated profits for multinational companies and cutting the capital gains tax to zero.

Cain also downplayed charges by his New Hampshire campaign staffer Matt Murphy, who recently quit, that he wasn’t spending enough time in the primary state. He said that his 14 visits to New Hampshire and 21 visits to Iowa this year represent a serious effort by his campaign. He insists Murphy left for personal reasons he wouldn’t discuss, but Murphy said it was because of a lack of time and resources devoted to the state.

The Fox hosts closed the interview by asking Cain about some of the jokes comedian Jon Stewart made at his expense, including poking fun at early statements that he would not sign a bill longer than three pages (a promise he has since withdrawn). The question they put to Cain: were they racist?

“I do not believe it was racist, no. Liberals have a problem with black conservatives. With Jon being the liberal he is, it’s more that I’m a black conservative than it is because I happen to be a black man,” Cain said.

via Cain: Obama Wants Economic Worsening In Order to Raise Taxes.

The Founding Fathers Were Anti-War

June 28, 2011 Leave a comment

Whatever the president orders the military to do, it must not only be right but also essential to the freedom of every American.

This couldn’t be farther from the ideas of most of the founders. The Constitution reveals their suspicion of any permanent military establishment. The Congress is given the power to raise an army, but only for two years. This ensures that the people can disband the army during every Congressional election, as the House representatives are elected at the same intervals. The power to declare war is kept away from the president and given to Congress, where two separate bodies have to vote on it.

It is apparent from the document itself and the statements of many of its framers that they were very aware of the dangers to liberty that accompanied prolonged warfare or a standing army in peacetime. Contrary to what most Tea Partiers apparently believe, the founders were anti-war.

Remember that the colonists were reluctant to fight with the British right from the beginning. The colonial militia at Concord held their fire even after the British had fired upon them, killing two Americans. It was only when one of their commanding officers yelled “Fire, for God’s sake, fellow soldiers, fire!” that they fired upon the British. Three months later they sent the Olive Branch Petition to King George in an attempt to avoid all-out war.

Once the Constitution was ratified, the administrations of the first three U.S. presidents were dominated by efforts to avoid going to war. During Washington’s administration, pro-France Jeffersonians urged the president to take France’s side in its conflict with England. Instead, Washington approved the Jay Treaty, which normalized trade relations with Great Britain.

via The Founding Fathers Were Anti-War.

Obama’s Plan to Islamicize America

June 28, 2011 1 comment

The result could be tens of millions of Muslims fleeing to the US and Europe. President Obama would welcome these “brethren” on humanitarian grounds, and in effect, America would become a Muslim country.

(Excerpt) Read more at israeltoday.co.il …

via Obama’s Plan to Islamicize America.

How Congress Was Duped into Repealing Military Gay Ban

June 28, 2011 1 comment

One of the more sordid moments in recent congressional history came during last December’s lame-duck session. Democratic majorities on both sides of Capitol Hill rammed through a controversial repeal of the 1993 statute (wrongly described as “Don’t Ask, Don’t Tell“) which prohibited avowed homosexuals from serving in the armed forces.

The Senate and House leadership did so with scarcely any hearings and extremely limited opportunity for debate. This action amounted to a raw abuse of power, a last gasp by an Obama administration able and determined to appease gay activists – a key political constituency – before the setbacks of November’s elections made doing so vastly more difficult.

We now know, however, that it was a gambit made possible by deliberate efforts by senior executive branch officials to mislead the Congress into taking a step that the administration’s own surveys had established would be deeply injurious to the U.S. military. Thanks to the release of a previously undisclosed Defense Department Inspector General investigation report, recently analyzed by the invaluable Center for Military Readiness (CMR), legislators now have the proverbial “smoking gun” revealing politically motivated misconduct at the highest levels of government.

(Excerpt) Read more at centerforsecuritypolicy.org …

via How Congress Was Duped into Repealing Military Gay Ban.

Whom Does the Law Serve? by Paul Craig Roberts

June 28, 2011 1 comment

Whereas the police are required to respond to charges by questioning the accused, they are not supposed to make a public spectacle of him in order to create the impression that he is guilty before he is even charged. Yet DSK was arrested aboard an airliner as it was about to depart for France and portrayed by the police as a fleeing criminal. Photos were released of him in handcuffs and stripped of his business attire.

The judge refused bail to one of the West’s most high profile persons on the basis of the prosecutor’s statement that DSK would flee the country and hide out abroad. All of this quickly was passed to reporters, who obliged the prosecutors and police by portraying DSK as obviously guilty as he was apprehended fleeing from the country.

The police even planted the story that DSK was in such a hurry to flee that he left behind his cell phone and that that is how they found him. This was a ball-faced lie. The fact of the matter is that when DSK arrived at the airport, he discovered that he had left his cell phone and called the hotel, the scene of the alleged crime, to ask that it be retrieved and brought to him at the airport. When the police boarded his flight, he asked them, “Did you bring my cell phone.” He had no idea the police were there to detain him for questioning.

via Whom Does the Law Serve? by Paul Craig Roberts.

“I’m Not Who You Think I Am” (Leo Donofrio)

June 28, 2011 Leave a comment

I have to get this off my chest. Many of my readers seem to be under the false impression that I am a Republican pundit conservative. I’m really sick of that. I have absolutely no respect for either the GOP or the DNC. The only political party I can relate to in any way is the Libertarian party, but I don’t agree with them on every point either. I have a simple rule that works for me: I severely distrust all politicians all the time… always, every single one.

For those who wish to put me in a political right wing corner, who ask me to speak at political functions, who want me to join the tea party movement — stop. You really don’t know me. I’m not who you think I am. So, let me update you on a few things.

I’ve just written and directed

via “I’m Not Who You Think I Am” (Leo Donofrio).

Could Romney As GOP Nominee Sway Supreme Court To Uphold ObamaCare?

June 28, 2011 Leave a comment

Nominating Romney could potentially sway the Supreme Court, which may offer the best chance for blocking the health law from fully coming into the force. The court could end up weighing the health care law in the midst of the 2012 presidential election.

David Bernstein, a law professor at George Mason University, made the following observation over how the views of conservatives at different times appear to influence conservative justices:

(Excerpt) Read more at blogs.investors.com …

via Could Romney As GOP Nominee Sway Supreme Court To Uphold ObamaCare?.

What The Fukushima Is Going On In Omaha?

June 28, 2011 2 comments

In the immediate aftermath of the Fukushima nuclear disaster, Japanese officials assured everyone that everything was alright; everything was under control, that the problem was limited and controllable. It took a few days for that lie to fall apart.

This time, it may be our turn. Something bad is happening in Nebraska. A state of emergency was declared for two counties where two nuclear plants are located – one at the Fort Calhoun nuclear facility and one at the Cooper Nuclear Station near Brownsville. Due to flooding from the Missouri River, some kind of emergency event is happening or about to happen there. The government is telling us not to worry, that there are just some precautionary measures going on to prevent a disaster from happening because of the flooding.

Makeshift barriers have been erected at the Fort Calhoun plant because the current river level is two feet above the ground level of the plant. At the Cooper facility, another three inches of water and the facility will be closed. There were two tornadoes in the area a few days ago with winds of 85 mph.

Without the barriers, the plants

via What The Fukushima Is Going On In Omaha?.

Military Retirement on Chopping Block?

June 28, 2011 Leave a comment

(READER RESPONSE: Gunny G)

Fergit Mil Retirement—the gubmint is not good for its bs promises—See Col Day’s story, former WWII Marine, Ret AF pilot, POW, etc.

get yer paycheck up front, pay, allowances, quarters, medical, etc. all in one lump sum paycheck!!!!!

Old Marines Saying:

Ya Can shock the sh!t troops…

But ya cannot sh!t the shock troops

Semper Honest!

Just Plain Dick

*****

(A Constitution changed from Freedom, can never be restored; Liberty, once lost, is lost forever…)

via Military Retirement on Chopping Block?.

Blue State liberals are not like us; they just aren’t «Coach is Right

June 28, 2011 Leave a comment

The Left is painting itself into a corner that is accelerating the destruction of its fortresses across the country. The red ink soaked Democrats who control Illinois New York California and Massachusetts are seemingly doing everything they can to drive their states into bankruptcy.

While Red States such as Alabama Georgia and Arizona have busied themselves passing firm anti-illegal alien laws, America’s Bluest States are busy committing social and financial suicide and taking their dwindling number of American patriots with them.

To make it harder for the police to protect their citizens from criminal illegal aliens all four of these Blue states have withdrawn from participation in the federal “Secure Communities” program which helps local law enforcers identify and deport illegal alien felons in their custody.

As if to underscore how counterproductive pulling out of this program is, at about the same time the Democrats in these states were sabotaging efforts to protect their citizens from foreign criminals, U.S. Immigration and Customs officials were announcing the arrest of some 2400 criminal who are illegally in our country.

Democrats and illegal aliens

via Blue State liberals are not like us; they just aren’t «Coach is Right.

BLOGGER.GUNNY.G.1984(+) Latest Posts @ Gunny G’s…

June 28, 2011 Leave a comment

BLOGGER.GUNNY.G.1984(+)

NEWS*VIEWS*POLITICS*HISTORY*LAW*GOVERNMENT, Etc.

(“Fair Use” Excerpts Linked Back To Source.)

via BLOGGER.GUNNY.G.1984(+).

**********
Hey, See the Reader Responses on each article,
they are gems in themselves!

**********

http://i46.tinypic.com/2rptut4.jpg
**********
Gunny G: BLOGGER 1984 +
http://gunnyg.blogspot.com

and…
http://gunnyg.wordpress.com/

**********

**********
**********

Is revolution brewing in America? By Michael Webster (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 1 comment

February 12, 2009 The deep depression that started in America has already triggered violence in many places around the world and is being played out in Europe and elsewhere with increasing violence and other forms of social unrest are spreading around the globe. In Iceland for example the government has already fallen. Hundreds of thousands of concerned citizens have marched in Zaragoza in protest to the failing economy and reacting to the great … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

The Revolution Will Not Be American | Strike-The-Root: A Journal Of Liberty (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

The Revolution Will Not Be American | Strike-The-Root: A Journal Of Liberty The Revolution Will Not Be American | Strike-The-Root: A Journal Of Liberty: "We have websites and forums and articles like this one that we toss into the most receptive and pervasive communication maelstrom mankind has ever birthed. We have people in jail, people in morgues, and people on the lam screaming liberty and freedom the whole way. We can arguably posit that the … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

MORE REPUBLICAN SLIME by Alan Stang (via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL))

June 28, 2011 Leave a comment

MORE REPUBLICAN SLIME by Alan Stang October 16, 2008 NewsWithViews.com [Announcement: Did you know Alan Stang has a new radio show? Click here for details.] The first Barney Frank scandal involved a sodomite prostitution ring operating out of Barney's Washington apartment. Barney wasn't implicated, of course. It is true that his partner in buggery at the time was running the ring, and customers were going in and out, but Barney "didn't know," which if true proves he is stupid enoug … Read More

via ~ BLOGGER.GUNNY.G.1984 ~ (BLOG & EMAIL)

Follow

Get every new post delivered to your Inbox.

Join 684 other followers